SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_025_00332.1|PACid:22063243 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_025_00332.1|PACid:22063243
Domain Number 1 Region: 67-159
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.15e-20
Family Cold shock DNA-binding domain-like 0.00098
Further Details:      
 
Domain Number 2 Region: 155-236
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.26e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00091
Further Details:      
 
Domain Number 3 Region: 6-67
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 3.45e-18
Family ECR1 N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_025_00332.1|PACid:22063243
Sequence length 237
Sequence
MVSNASSSFIDQTVVPGDVVLDLSKMINQTIKLGEGLRQDGDAISVMKAGKLKFSKPNKY
WVETSQKRYVPHVDDNILGIVVDQKGENFLVDIKGPTLAFLPVLAFEGGTRRNIPKFEVG
TLLYVRVVKANSGMNPELSCTDANGKAAEFGPLKEGYTFESSTALARTLLSSPTCPVLEA
LGKKLSFEIAVGLNGRVWVNAESPSTVILVSNAIMTSESLSGVQQRIMVDKLMQRMK
Download sequence
Identical sequences A0A2G5DAJ9
Aquca_025_00332.1|PACid:22063243 Aquca_025_00332.2|PACid:22063244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]