SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00741.1|PACid:22051863 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00741.1|PACid:22051863
Domain Number 1 Region: 12-177
Classification Level Classification E-value
Superfamily At5g01610-like 1.02e-46
Family At5g01610-like 0.00000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00741.1|PACid:22051863
Sequence length 178
Sequence
MEKALTTVGSFKAGSFWISKKAKEEISNISEDLSALSNTVEEKAKWVFNKLKGKPPKSLP
DLLREYNLPPGLFPRNITCYEFDEAKAKLIVYLPSVSEVSFKDSSVIRYATRVKGTLLRG
KLTGVEGMKTKLLVWVKVTNVAVEGYKSDKVWFTAGVKKSRPKDAYEVPRDAVKVDEF
Download sequence
Identical sequences A0A2G5F4Q8
Aquca_002_00741.1|PACid:22051863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]