SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00034.2|PACid:22035105 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00034.2|PACid:22035105
Domain Number 1 Region: 165-241
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000541
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 262-293
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000209
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 3 Region: 100-131
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000275
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 37-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000929
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00034.2|PACid:22035105
Sequence length 297
Sequence
MDFGRARKRGRPEAGFNGNAGFKKNKQEMDSFPGIGSKSKPCTKFFSTAGCPFGEGCHFL
HYVPGGINTVAQMTNMGGNPALPPRNAMAPPPFPDGSSQTAKTRMCKKFNSAEGCKFGDK
CHFSHGGREIGMPFAPSREDPRAMGPNMGRYAGRPEQPPPGLAAAASFGASATAKISVDA
SLAGAIIGKGGVNSKQICRITGAKLSIRENESDPNLKNIELEGTFDQIKQASAMVRELIV
NISSTAGPMSKPAAPAPATPANNFKTKLCENFAKGSCTFGERCHFAHGTAELRKQGA
Download sequence
Identical sequences A0A2G5EBM0
Aquca_009_00034.1|PACid:22035104 Aquca_009_00034.2|PACid:22035105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]