SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00034.3|PACid:22035106 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00034.3|PACid:22035106
Domain Number 1 Region: 93-169
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 190-221
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000131
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 3 Region: 28-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000183
Family CCCH zinc finger 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00034.3|PACid:22035106
Sequence length 225
Sequence
MTNMGGNPALPPRNAMAPPPFPDGSSQTAKTRMCKKFNSAEGCKFGDKCHFSHGGREIGM
PFAPSREDPRAMGPNMGRYAGRPEQPPPGLAAAASFGASATAKISVDASLAGAIIGKGGV
NSKQICRITGAKLSIRENESDPNLKNIELEGTFDQIKQASAMVRELIVNISSTAGPMSKP
AAPAPATPANNFKTKLCENFAKGSCTFGERCHFAHGTAELRKQGA
Download sequence
Identical sequences A0A2G5EBL5
Aquca_009_00034.3|PACid:22035106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]