SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00537.7|PACid:22038073 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00537.7|PACid:22038073
Domain Number 1 Region: 74-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.77e-26
Family alpha-D-mannose-specific plant lectins 0.0077
Further Details:      
 
Weak hits

Sequence:  Aquca_011_00537.7|PACid:22038073
Domain Number - Region: 353-412
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0667
Family Anti-platelet protein 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00537.7|PACid:22038073
Sequence length 452
Sequence
MGRLYFVMFYAYILTLLSQEIPIAAYMLTSSQSIIDGKTLVSKGASFELGFFSPPSSKHR
YFGIWYKPVSVQTVVWVANRDSPITDTSGALKIGSTGNIVVVNQNDSVVIWSSKSTSSNI
AVENLIIELLDSGNLVLRDVRIEDPEKYLWQSFDYPGDTLLPGMKLGWKSKTGMNNYMQS
WRNSDDPSLGDYTFGIELTEYPESVILTNKSIKYYRSGPWNGLQFSGAPDMSRNRVFHYE
LVHNPDEVYYIYKVTDPSVTLRVVLTQTSTEGHLQRFTWVNQTQSWLLLVSIPRDRCDDY
ALCGAYSTCEVMTEPVCQCLKGFKPKSPQDWNETDWSQGCKRETFLNCSQGEGFLKYTGV
KLPDTTGTRVNRSMDLEECGVNCLKNCSCVAYSSSDISGSGSGCVMWFTDLIDIRQMDGA
GEDLYIRMAASELGLGLLFLLMQLKLITPLHN
Download sequence
Identical sequences A0A2G5E7K3
Aquca_011_00537.6|PACid:22038072 Aquca_011_00537.7|PACid:22038073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]