SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0010_01631T0 from Acinetobacter baumannii ATCC 19606

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0010_01631T0
Domain Number 1 Region: 141-304
Classification Level Classification E-value
Superfamily PP2C-like 0.0000719
Family PP2C-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMPREF0010_01631T0
Sequence length 322
Comment | HMPREF0010_01631 | Acinetobacter baumannii ATCC 19606 stage II sporulation protein E family protein (323 aa)
Sequence
MYFIKPTRSIPFVEQALEALPDLQVIHIDDLDLYDPTIIAIADVQDFLTYKWRLPTIVIA
FEHEGSALAQAWEAGALAGWVWNQLPKDLNKALTRIDAQYKRNQDSRDLPSAAELQKRLL
PNPIDLLNYEVETFFQPSAYLSGDWYDYWKLNDKEVLFYLADVSGHGVTSSLLTSWMAAF
HGRSKTPRQLIKKLNGMLVQENIEKHITIVVGILNLETHSLRWSSAGHYPPPIIFEPNQS
PKILTTSSFPLGLTDELEVEEHVCTLNRHARFIICSDGALEPFDGGLNDQFQQLVQHLQN
QSFQAPDHVADDIAIFSLCRMN
Download sequence
Identical sequences D0CA51 V5VGA7
WP_000273590.1.12358 WP_000273590.1.12837 WP_000273590.1.19750 WP_000273590.1.20755 WP_000273590.1.21167 WP_000273590.1.22216 WP_000273590.1.23674 WP_000273590.1.23771 WP_000273590.1.24586 WP_000273590.1.30173 WP_000273590.1.35081 WP_000273590.1.36381 WP_000273590.1.39036 WP_000273590.1.43088 WP_000273590.1.43672 WP_000273590.1.44244 WP_000273590.1.46553 WP_000273590.1.47607 WP_000273590.1.54171 WP_000273590.1.56154 WP_000273590.1.57250 WP_000273590.1.59417 WP_000273590.1.60109 WP_000273590.1.60144 WP_000273590.1.62032 WP_000273590.1.62435 WP_000273590.1.63537 WP_000273590.1.64177 WP_000273590.1.64658 WP_000273590.1.67141 WP_000273590.1.68086 WP_000273590.1.72577 WP_000273590.1.74322 WP_000273590.1.76585 WP_000273590.1.77164 WP_000273590.1.77776 WP_000273590.1.77969 WP_000273590.1.78094 WP_000273590.1.79797 WP_000273590.1.80712 WP_000273590.1.839 WP_000273590.1.85831 WP_000273590.1.88851 WP_000273590.1.90399 WP_000273590.1.91906 WP_000273590.1.97404 WP_000273590.1.99395 HMPREF0010_01631T0 gi|469820810|ref|YP_007595180.1| gi|565639477|ref|YP_008891720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]