SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0026_02720T0 from Acinetobacter junii SH205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0026_02720T0
Domain Number 1 Region: 142-286
Classification Level Classification E-value
Superfamily PP2C-like 0.00000196
Family PP2C-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMPREF0026_02720T0
Sequence length 322
Comment | HMPREF0026_02720 | Acinetobacter junii SH205 conserved hypothetical protein (323 aa)
Sequence
MYFIQPSRSIPCLDQALNELPSLQIIQADDLDLYDQTIIAIADVQDFLKYQWKLPTIVLA
FEDEGAALAQAWEMGALAGWIWNNLPKNPIHALFKIDAQYKRNQDSRDLPSAAALQKRLL
PNPISLPNYEVESFFQPSAYLSGDWYDYWKLNEYEVLFYLADVSGHGVTSSLLTSWMAAF
HGRSKTPRQLIQKLNAMLVQENIEKHITMVAGILNLQTHEITWSSAGHYPPPIIFEPNQA
PQILTTSSFPLGLTEDLDVEEHICKLNPDARFILCSDGALEPFDGGLNDQFNQLVDHLQN
NSFQAPEHVADDIAILSICRMN
Download sequence
Identical sequences A0A2D3F448 D0SQG0 N9C3N1
HMPREF0026_02720T0 WP_004955739.1.30501 WP_004955739.1.61352 WP_004955739.1.73603 WP_004955739.1.93638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]