SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMPREF0026_02852T0 from Acinetobacter junii SH205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0026_02852T0
Domain Number 1 Region: 25-235
Classification Level Classification E-value
Superfamily PP2C-like 4.19e-20
Family PP2C-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMPREF0026_02852T0
Sequence length 236
Comment | HMPREF0026_02852 | Acinetobacter junii SH205 predicted protein (237 aa)
Sequence
MAKSILINSFSLCQNLSAPEKFGIDAVGNLTDNENLYFCYVVDGHGGCKNSDILVKNFQA
YVLSLKDVFAQLNNTTQDIHDFFERLTENFYIEHRGKLRPAAMSILMVIFSQTQIYSAHL
GDCRLGKINNEQQISWITYPHNLAMSLNNQTDPQSIEMILRSSSNDNIVTKSFNTKKLKP
LSFKTLDIEKKSTYILASDGFWKLSENDIKTIIYSKNLSEVSSLFDDISLWVISFI
Download sequence
Identical sequences A0A124EZN3 A0A1V2UQI6 D0SQU2 N8XHI9 N9P8J7
WP_004827016.1.13762 WP_004827016.1.20686 WP_004827016.1.63232 WP_004827016.1.73238 WP_004827016.1.93638 WP_004827016.1.96730 HMPREF0026_02852T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]