SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMPREF0017_01625T0 from Acinetobacter lwoffii SH145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0017_01625T0
Domain Number 1 Region: 245-547
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-49
Family Protein kinases, catalytic subunit 0.00041
Further Details:      
 
Domain Number 2 Region: 6-238
Classification Level Classification E-value
Superfamily PP2C-like 1.57e-48
Family PP2C-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMPREF0017_01625T0
Sequence length 576
Comment | HMPREF0017_01625 | Acinetobacter lwoffii SH145 serine/threonine protein kinase (577 aa)
Sequence
MNKKLKISVGQYSSAGIKAQNQDFHGVYIPEGHALSSKGIACAIADGISSSNVSHIAAET
AVSSFLSDYYSTSEAWSTQTSAARVIRATNSWLYAQTQQSRGRFDKDRGYICTFSALILK
QNRAHIFHAGDSRIYRIQTQAIEQLTADHRVCLSSTEHYLSRALGADHPIDVDYQQLELC
EDDFFILMTDGVYEFIDMQLISEMLQQQQHLDIIAKSIVELALKRGSDDNLTIQIIKVQQ
LPDEESFHIKSHVLFPQQLSHGDLFEGYRIDKILHQNHRSSLYLAHDEATQNQLVIKTLS
VDVQDDLQAMEQFQLEDWVSKRLKHENLLQCYPHKGSKKFLFQSYEYLQGESLNRWLHRH
KTALTLQQLLPIIEQVAKALNAMHRLEMLHQDVRPENVMLLEPADTLKVKLIDYGSTAVR
GLVELNPKHADVPLGTLAFMAPEYFIGRSPSVKSDQFSLAVMSYYLLTRQLPYGTDLARC
KTEKALKQVRYHPLYEYRPDLPHGLDAIFKKALSIRPEQRYEALSAFIYDLKHPDIKFKK
SVSRPMLEKHPVTFWKSCTAILFLLLLWVFALYFSQ
Download sequence
Identical sequences D0SWF1
WP_004280336.1.15330 HMPREF0017_01625T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]