SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMPREF0017_02623T0 from Acinetobacter lwoffii SH145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0017_02623T0
Domain Number 1 Region: 39-259
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.45e-42
Family Phospholipase D 0.025
Further Details:      
 
Domain Number 2 Region: 329-522
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.47e-29
Family Nuclease 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMPREF0017_02623T0
Sequence length 544
Comment | HMPREF0017_02623 | Acinetobacter lwoffii SH145 phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase (545 aa)
Sequence
MATAPRDQVHLQSSSFIRTHRYKAGILLSCSLVLGLPACSTLPKQTEQPSQMAFETDTSQ
TSLAQIVEPLRDQNIGLTGYRVLYDPLEALAARIQLINKAERSLDLQYYIWDNDRIGALA
LHAIIQAADRGVKVRLLMDDNNAKKMEGIYLALNQHQNIDVKLYNPYRFRKYRAMDMVLD
LKRINRRMHNKSFIADNQIALIGGRNMSNQYYNVSESYQFSDVDVMLVGAASDEIIHSFD
EYWNDDYAYPVQEVVNPRHHGLRFPSLKEQLETHSQDPATQNYLDLANRSRAFDQWLEQN
IQLDWVEAEVVKDPPSKIKAKAKTEEHLNFQLLQRLEKPEQSVDIVSAYFVPEKIGADRL
KKLANENIKVRVLTNSFKANDVAVVHAFYAKYRQDLLENGVQLYEFLAAPEANHLNANTE
EISKKAKVSLKGLSRSSLHAKLMALDQKQVFIGSFNFDPRSAYLNTEIGVLLNSPSLARA
VHDTMDKNLSKYAYKLVLDANQNINWKIKKANGEVQTFSKEPKMKWYQKASLKLVSWLPI
EGFM
Download sequence
Identical sequences D0SZ99 N9HGI3
HMPREF0017_02623T0 WP_004281694.1.15330 WP_004281694.1.1813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]