SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339634218|ref|YP_004725859.1| from Weissella koreensis KACC 15510

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339634218|ref|YP_004725859.1|
Domain Number 1 Region: 279-449
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 1.7e-41
Family MgtE membrane domain-like 0.0000523
Further Details:      
 
Domain Number 2 Region: 140-275
Classification Level Classification E-value
Superfamily CBS-domain pair 1.17e-32
Family CBS-domain pair 0.0000294
Further Details:      
 
Domain Number 3 Region: 15-138
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 1.7e-25
Family MgtE N-terminal domain-like 0.0000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339634218|ref|YP_004725859.1|
Sequence length 453
Comment magnesium transporter [Weissella koreensis KACC 15510]
Sequence
MVNDELRSEIIPIYKRIVRDLKHGAQDDFKLCFFDLHNYDQAQIYQALPPQLRHQLIEWI
DPMELADVFDLIEPEVVEEDQLLSEMTPRYAADVLNEMYVDNAVDVLDEMPEAQQEHYLK
QLSDTDAKEIRNLLGYADQTAGSLMTPEYVGISSQASIGEALSLVKQFAEESEQISYIYV
VEQEKLIGVISLRSLIVHPDHEKVQDVMTQSLVTVQPGDDQEIVARLMADYDLVAIPVVN
EQNKMLGIIMIDDILDVIEAESAEDYERFAGVHNLDLEESPFQSIFKRLPWLIVLVFLGL
GTASIINHYDQLVQQMSVLAVFISLITGTAGNAGTQALAVSIRRITLKEKKGTLIMFLTE
LLIGLSIGLITGGTILLVVWIWKANFLLGLAVGLAMAGAITVANLAGAFVPLLMESLKID
PAVASGPFISTLSDLTSVIIYFNIASWILNVWV
Download sequence
Identical sequences F8I0F2 J0WBC3
gi|339634218|ref|YP_004725859.1| WP_006845747.1.23087 WP_006845747.1.42504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]