SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMPREF0014_03354T0 from Acinetobacter genomosp. 13TU RUH2624

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0014_03354T0
Domain Number 1 Region: 33-259
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.54e-44
Family Phospholipase D 0.047
Further Details:      
 
Domain Number 2 Region: 332-505
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.63e-29
Family Nuclease 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMPREF0014_03354T0
Sequence length 543
Comment | HMPREF0014_03354 | Acinetobacter sp. 13TU RUH2624 phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase (544 aa)
Sequence
MIMAQSFHSKQLQTHQQAKGFLIKASLIVCSSFAVTLTGCSTLPKHRVEPVQYARDIDTS
QTSLAKIITPLREQNPNLTGYHLLNDPLEALAARLRLIDKAEKTLDLQYYIWDNDKVGAL
ALHAIIRAADRGVKVRLLIDDNNAKKMEGVLLALSQHKNIEVKLFNPYRFRKYRAMDMLL
DLKRINHRMHNKSFIADNQVALIGGRNMTNQYYNVSDSYQFSDVDVMLVGAAVDDIVNSF
DDYWNHEYAYSVQSIVSAQQHRLRYESLKEQLDAHYQQATVQNFLNLTSRSHAFDKWLDH
NIQFDWVKAEVVKDSPDKIKSKAKKEEHLNFQLINHLEKPESNVDLISAYFIPEKQGAKI
LSTLAKEGVEVRVLTNSFKANDVAVVHAFYGRYRKELLKNGVQLYEFLPTPDKRNLNKNT
DELATKAKVNMKGLSRSSLHTKLMALDEQVFIGSFNFDPRSAYLNTEIGVILDSPSLAKT
IHHTMDENLNKYAYKLKLDPNNNIYWQQETSKGPVIYKKEPEMKWWQKAGMKFLSWLPLE
GFM
Download sequence
Identical sequences HMPREF0014_03354T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]