SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00143 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00143
Domain Number 1 Region: 1704-1983
Classification Level Classification E-value
Superfamily Kelch motif 8.89e-48
Family Kelch motif 0.014
Further Details:      
 
Domain Number 2 Region: 450-720
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-30
Family Kelch motif 0.016
Further Details:      
 
Domain Number 3 Region: 40-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-21
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 4 Region: 1418-1466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000062
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 5 Region: 204-270
Classification Level Classification E-value
Superfamily Kelch motif 0.000000012
Family Kelch motif 0.013
Further Details:      
 
Domain Number 6 Region: 1295-1330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 7 Region: 2481-2530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  Aech_00143
Domain Number - Region: 1371-1418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000176
Family Laminin-type module 0.015
Further Details:      
 
Domain Number - Region: 1527-1612
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000196
Family Spermadhesin, CUB domain 0.0067
Further Details:      
 
Domain Number - Region: 2393-2534
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000471
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number - Region: 2571-2611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family Laminin-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_00143
Sequence length 3031
Comment [mRNA] locus=scaffold121:2148413:2160672:+ [translate_table: standard]
Sequence
MGWTISTTAWIVIWSCLLPGFYLAPQASPKQVPCDKTRKVFMESWGIISDGPMGSNYTQD
SHCEWLIKANHSRQFITLSFRTMGTECSYDYVFVYDGDSFRSPLLGSFSGKTEPQQVTSS
SGYMLILLYSDTNYVLDGFHAEFSVTDCPNNCTHHGKCINNTCFCENDWGSKDCSRALCP
NNCSQAGICGIKRCKCNNGYSGQSCSLHKTHPEGNRWHWLSHSEGGLRPRAAHTAIYVQE
TDSLYVFGGYDLNYILSDLEVYRFSTSEWEDEYGSILEGAASAEYLDPTLIATELQRHPG
AKEIYGLPTTSLFWKVLYSIKDNNTFGLLDRTADGQHSREFRNMPKDKEIEKSRSTIRID
RNGDPRRKHPRNIRPRYSQMSTRUYRRNLENLYRERDATDMQNEDVKWEEQIVAGSAEEN
VFIPEFTDSKSTTSDSLKEEVTEPTVDELPKPSPRYGHAACKYQDGFVIYGGKVEDGTLS
NELWHYNVIKRMWTLRAKNSPFYPPSLTRHTLTLASDYIYLFGGSTVDGEFSSSLYKIKL
RLSDLTAINERWIEVRPRGGKELDVRVVAHSTVYHRATNSLLVYGGVVASVARFSKLSDR
MFVFQLDRKVWSEIHYPRAHLRETYVPRERAFHTCNIIGNYLVVFGGYSHRHNKEEICYD
NQMYLYHLGCHTWVSHEVLGLNDKDSRYPKQQGVFAHAADVRNGNTLLLVGGYHGNVNAD
LLAYTLPPMLAPGDEDYIEPEQICSRHKSLMECAANPECGWCSADEICYGRTIGSNCTTN
LQTTRCPGVCPALGDCHSCLIHGQPGGGWGTNFRGRKSVSNKLNLGTCTWCVQNARCHHK
DDNYGVCGLRDDTPSQIPGWWGSKGTEITKAEECREMDKRPGLTFLKYKPPVNFSQPDSV
AIVNATTVDFNVPSMQGAKTESALGGEMIARLTGFLRPPNYFWDSATEHLKICVSYNSAT
LHVSRNDDPDKLELVANLTAETSQCIPTTWPGEDSMELQSGRYLLDFESKRMVTTSYAYA
SKMEIVHNKNMENGKVFTFEYLEPYQNGSCHQYSNCLHCLTDSSCGWCDITNECLPRSVN
ETESCVKDVEWDKERDETIREWHYLTITPSACANCSNYISCESCVNTKLCEWWTEEARCA
RIGRLPNAVVSLYECPIPCRQRSNCTKCLDERGRCVWCEATQECFSFSVYTSEYQFGLCR
EWMDQAGLMGVTSRSGSALTGNDQCKSCSRHSNCSSCLHSLSCGWCYSLENPITGVCVQG
DFNQAHVNCSAIINEYRNSSLNADESGWAYAQCPDVDECDLGLHDCHPDALCTNTHGSFS
CQCKRGFNGDGKENCTKTCYERCVNGYCSEAPDYKCECNLGWTGPDCRTNCGCYNHSTCL
QGPGICDECQDWTIGRYCEECKAGSYGNATTPLGCRECNCNGHGDVELDVCDRQTGMCFC
RDNTEGDKCQRCKRGYYGDPRNGGMCYYGCMSRGMLGGEGNGKQGLGSRHSQSSLWDNYV
GDSPTRECLWIVGPETELSLDATTPTIQSVIQFTIHDDINVSCQENSVYVYDGLPEFVSS
TGGHQSQLLGVYCTESTNYPVTVEAKSGFLTVHYKQLDEVEGFNASYVIMTCNNCPGNRE
CRNGNCLCKSGYVGINCDVEICPENCTASEKRGVCDKGYGRCVCVPGYGGRDCSILLKNY
QLTFTELFNSEYLADHQDHLRKTLPRFGHSLVADRRGSLWMFGGYSLSHGPLNDIRLFDT
KNNTWMQVTVESTSEASMPQGRYFHAAEIVHSRQQIYVYGGLSMKDEDIQGLSNNTLSDF
WKFSLQNQRWSQIVQDELKKEPLPLAGHTLTLRRDGESESLILIGGFSPKYGYLDVIWEF
NLETETWDTVNTVGNGPVGVYGHSTVYHSKSDSLYVFGGYTYAVNRTFISNRLYALNYKI
RTWSVLPPFEDEITDGNSLPQARFLHSAVTTDEYMVIFGGRQNPHNTSDSLIAYKYSCNL
WIRLITKDTETIGSPPPPAYAHAMTHADPESNAVYVIGGFDGGIKSHVTLINIPEDLCNL
WKDKITCRKYFGCSFCAVTTLNGINISLCFSNEVSSNRGDKCDINVTQAQRSNGIFCNSD
WMASRKCQTFRTCTECLAEWPYYKDNEPVCKWCTNCPHGKCIPSDKDCNDQTQDMRCDTS
VSNVNQCGERLCPASDCEKCYGLDECVWTRQVLKTNELGMELTGEPVYDWNCVKINIFER
TSIKMSSTQCEKRCSDHKDCRSCLKGTGAEGGWSECRWSTQLNECISPSYQPLYCAGGVC
GLVLRNADMDHCPEPCSVFKQCSTCLKHSHCGWCSLDSANVTGQGICTEGSLEAPADHPA
GGTCEMLYRQHFPEVESPITTTLHPYHVDSSEAQDNVTMSLLTTVLKPDFSWHYVRCPPE
NECENGHHTCSPKSEKCFDLEEGFECKCGDGYKTETTWGNDFGKKICVPMCTQGCVRGTC
VKPDLCRCDFGYVGSNCSIQCQCNGHSDCAGPDKLDNCTKCHNNTMGKQCEKCLPLYVGN
PADNGQCVPCLEYCNGHTRICINDNVTVPDPNSVDKMSIEKLSRQLEEGPVAKAKCINCG
NNTRGDKCGECMTGYFRGTEDLRDVCRPCECHGHGFTCDPVTGEKCNCGNNTESEPSCTS
GPIKGTNMGGTPCWMVQCSKCRENYAGTPTMGHQCYKTVTVDNKMCFDSKLIDECKMKPK
PLNPGQTVFYMVQPRFMNVDIRVMVDVTQGALNLFLSPRDDSFVVILNSTTGYQEVELDN
RFRLRPDQPSNRFRIVEFHPHLGTAINGSTMEPIRWNTGQQYFVMEHWLEDNLASFLTIE
RRNTFLVIHNLTNRLVLTLPQDKHELGQTKFHIVLQAIDPVNPELNGRAAYGMIFFRQDQ
LHIDLFVFFSCFFSCFFLFLAGCVVAWKAKQSADLRRARRRHVVEMLHMAKRPFASATIL
YDRDGGECSPSSPQRKGRRGKHVSFHSDVRPVAVEPTDDGVAAVATVFIRLPGGRQAPVK
LALGSSLILLTRVYPVNSRVFLRRRNSHATN
Download sequence
Identical sequences Aech_00143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]