SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00331 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00331
Domain Number 1 Region: 69-184
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000144
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_00331
Sequence length 331
Comment [mRNA] locus=scaffold326:438105:447670:+ [translate_table: standard]
Sequence
MFSKSTSTILLVIIIIIGATFHVAKAAIDNDRRQQQITNEAVANILAYEAEAKSSLEVPR
EHYRPITDCMFVTSESGPFSYISPTDDDNVCGIYFLTDPDRVVEIHFHSFDVPCDHQGLL
AVIDGWELNGEVFPSERDHSLSMKERTNEFCGKNKWYRKTFTSSQNAALLQYRVPLRGKG
FVISARYQKNPRPCNILSVSTTDPFTLRNYGRRINCTLVAVYPGVVQIIALGIGGSSHGV
VHTTETGTLHKCDARSPRDQVQIGGSHGFDTIKFDVIDSICGIDSKPDIKELVAYDVTVV
RLLSSGYYDNSVTVAISPIVDNSLLDSASGL
Download sequence
Identical sequences F4WMI2
Aech_00331 XP_011055528.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]