SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00442 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00442
Domain Number 1 Region: 151-308
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-41
Family G proteins 0.0000382
Further Details:      
 
Domain Number 2 Region: 23-156
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 1.01e-23
Family Obg GTP-binding protein N-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_00442
Sequence length 388
Comment [mRNA] locus=scaffold326:1515719:1517146:+ [translate_table: standard]
Sequence
MVFWTQVLLASVKKQPRRYLRSRFIDTLRFHVRGGTGGGGLSRYGGIGGAGGNIYLVAKD
GLTLEKVANTLKTKRIIAECGHDSSARGIIGAPGQDKNISVPRGILVYNQNGVLLGDLNE
EDSKILIAKGGLGGTKDTNYCGLKGESQVIKLDLKLIADIGLVGFPNAGKSTFLAAVSNA
KPKIANYPFTTIRPRLGIMNYDDLREITIADLPGLIEGAHMNIGMGHKFLKHIERTKLLM
FIVDIQGFQLSPRHGYRSCLETIVLLNKEIELYKPDLLKMPAVLIINKMDTDNADNILKE
IKPALHNLSKYVSTCPEEMQPEQVLHFDSILPISLISKNKNIQIVKGRLRNILDKYEERK
NALEHNNLDSRLMERINRQSEEHTPIVV
Download sequence
Identical sequences F4WM43
Aech_00442 XP_011055726.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]