SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00623 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00623
Domain Number 1 Region: 4-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000537
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_00623
Sequence length 167
Comment [mRNA] locus=scaffold192:396844:404003:- [translate_table: standard]
Sequence
MYTCPPDYAEWYCLNGATCFTVKIVDSLLYNCLCAHGYIGQRCEFKDLDGSYLPSRQRVM
LETASIAGGATIAVFLVVIICIAAYIHCKRKQKELRSSNNCVDTVDGPGRDPELRPFSNR
SRSLMIFTAKNSNNSATIEQTRMPNWNCPETESMRMASISENKPSSQ
Download sequence
Identical sequences F4WC64
Aech_00623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]