SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00628 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_00628
Domain Number - Region: 338-377,505-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00118
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_00628
Sequence length 794
Comment [mRNA] locus=scaffold192:449075:452963:+ [translate_table: standard]
Sequence
MTCCKIYLTLSALITCHVSANYERLKNWDPSESTSHSWNNQYDFYESAPSEILPDYSFYE
LSKDRPIDRFGSPSESFPVTSKKEPIEEKYLKKIPFYVFSNKDSTRYKELTPDLGVAHCQ
EIKVKSIGKDGEPRKGVTTCYNCKDPKTKSTYERCLYSSHPEESVSANMKVENYLPTPTK
FRYRRSNYEENNNYGKLRNPYRFTDEYFTDATHDVPAAYENKGEKCDKIVKDSMVCMVCK
DAKTNGKYEQCSYVKQPHEKAYSYVKSSTFGKPEKSEENNNERPELTSHSKVSDFEASDH
QKDHSPSTESREYSYPSEDYSEKASTINEQDEVKDAPSSDCKQIQKDSKSCTVCKDSKTG
GTYEKCTYNYQPSDKLYKYSRSKTFGYPDKTESSDSTRDSRDSNKSQASEKSKNFDYPQS
SNFAPDYIDKSEHSTYPRKSNREVEAQKVPNDSDGTSHDTPEYSSDYSSSEASDYQFPSY
NSNPESYDGQKTSSSKPVSENYSENISEDNCKTLQKDSMTCKVCKDPQTGNDFEQCSYSY
QPKDKLFSYSKSSSFGNPQKSEQTSHEDEHPSDSSEVTKKSYDKYVPGLTYEASSTDEAT
SKDDAEGKKGVDAGYLDTVKKKAEIEEFMQKFQKEDRSNCKKIMRDKMTCYQCIDDKGFQ
KEECAFVTGQEPDKDQLVFHETKEFQVDSVPRVRAPSDFKPSSSTKTKAVESLEPSTSAS
KNSYVRLEKPDNDYPDEASHTAEETKEAEPYDYTSETKAKYDKVLRLTLPAYMFTTSEHE
AAFDEIVASDHDQR
Download sequence
Identical sequences F4WC69
XP_011050389.1.86870 Aech_00628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]