SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00718 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00718
Domain Number 1 Region: 120-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Laminin-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_00718
Sequence length 416
Comment [mRNA] locus=scaffold192:2052502:2066318:- [translate_table: standard]
Sequence
MRYRNARLPLSSLTSGVSRRELHNEFIGNERAHNEGTNDSLSPETSRTIRNNRYSDLGVE
SQTSFPTSTGDSGRRRRQFVSPAAVVATRNLDIDLKIILLNHQNNYVGNSSMMSKAGKTC
DCHPIGASGKTCNQSSGQCPCKDGVTGITCNRCARGYQQSRSHIAPCIICYQGGEQKKTP
ELLDHTRTALENDQSIDREEHATISTLDLLTLVQLGEICENVCATIGSGPILCFRRHGRL
LVSNRVSRTSVRVTKDYIVTCLRVSRRHNAYILPCKKAYRQQIPRVVQTQGTAGEESGEH
EDDDDERGYDGRAGKSYGFYRFNLQKITNSKNKSASIAEKVHLTRSTHAGCKSRGPPRTG
VIVVRYAAGSLLGPDLSRGPSAAAGMDPRDLTCPPPPLFISSAISHRYSTHNHSRF
Download sequence
Identical sequences F4WCF1
Aech_00718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]