SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00763 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00763
Domain Number 1 Region: 96-213
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000914
Family Cadherin 0.012
Further Details:      
 
Domain Number 2 Region: 10-115
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000971
Family Cadherin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_00763
Sequence length 448
Comment [mRNA] locus=scaffold192:3061602:3064736:+ [translate_table: standard]
Sequence
MLGGRLPVKFVLKNQQTSVPENTPSGSVLLTAGVNKADSNLKFWLVGPVEDLERFSITNS
GELILKGNLDYERRFQHSFLIHVTDGYHNDTSHVNVSVEDVNEWEPRFQYSRYEFHAHSA
REGSVVGKLEAADGDRGDKVNLSLRGQDARSFEIRDNGELVLRSLGSFNGSLARFIAVAT
DSGKPPRSSMIPVIVHIPNSGSLPIAARAAPAWLGSSVLLVAIFGAVLGLLGVVILILIL
YIYKHKRPKSGGSVSSVSTGYREKSPVPSALSPTPQVLGANVLQDGLEGPRNRRHDIEDE
NDNVDSRNEIDNPVFGETNESSYSTTIKSIASARQLPLYTRHKVAPAPNPPTLSATSTIP
NIGGLVQNMNDLSARTNLDAGSHDSSNYSGDPPDSLVPAWPASSALPRIKKLSWDDDDRT
VDSVEVAAETRTGDNQVGNERLNLTVYF
Download sequence
Identical sequences F4WCI4
Aech_00763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]