SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00827 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00827
Domain Number 1 Region: 323-364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000733
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_00827
Sequence length 384
Comment [mRNA] locus=scaffold192:3976596:3982252:+ [translate_table: standard]
Sequence
MAVCMFWLLTYVGQGLDLAVGNRPVIIQVQGTQGLDYRHGSSSIRKKSELSSVDNNLLHL
KIYPSDGPYRDDLSNWLVFNDEPRISSWSPAGMLIDDIVKEPREFQNVFFALSPAVLNVL
YSEYVTSQPHNAATQPHVAEPYVHDDGNHLLGGRQAHQRLKKRRIGCRHPLRGPLSLPIL
VCDEAGKKATTLQESRQSNHDDLYAEQRFNTATSTKTDLVRAEGGTPLNLPTNGGFVPKA
FVYETSGNKLPGSKRNQITVGRRSIDAQGESPGHQAQASSASSTSSAGASIASQLMLRSI
RGSIQYDVPQIECPVSEDGMERFACPTADRMGRYHCIDDHVLCDGFIDCPTGEDEDRQAC
MFYKTTKAHLDVLADAILRWARGR
Download sequence
Identical sequences F4WCP3
Aech_00827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]