SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00978 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00978
Domain Number 1 Region: 907-1121
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-90
Family Thrombospondin C-terminal domain 0.000000414
Further Details:      
 
Domain Number 2 Region: 784-904
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.18e-29
Family TSP type-3 repeat 0.000021
Further Details:      
 
Domain Number 3 Region: 704-790
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.15e-16
Family TSP type-3 repeat 0.0000617
Further Details:      
 
Domain Number 4 Region: 637-727
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000654
Family TSP type-3 repeat 0.00024
Further Details:      
 
Domain Number 5 Region: 450-612
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  Aech_00978
Domain Number - Region: 614-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00154
Family EGF-type module 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_00978
Sequence length 1160
Comment [mRNA] locus=scaffold99:1493958:1502938:+ [translate_table: standard]
Sequence
MRVPILLILGLLIYAVDGNIVPNEALTTSLQDVWFDDEFVIAISNFNKRKSDSPVETLLS
VKYLGKIKLVLMIDRRTKRVILESLDNTGRRSASHVKVDSISVNSPLKSLILLVYQVQPN
PRVDVYVDCNYQGSIPLKTTFRHIFANMDTLEGYVEVLKERKSRVKVYQTTITDVLKKEQ
CPDNLSEMKQPSVFETPKTQPIDSDEDYQNKSIDRPDETSDEINGSGSNNNDQWPSNNSK
FLWDKKLSNKKHPSDSNRPKKKDHSRHPKGKSKPDKYDPYDSSPPQSPIDRPKKHPKSDM
SDSESSGRRVPRRGDIGIQSLDEKVCQTDDQIVKTLNELINATRKLGRELELNRMETQHL
RHLIENCSACRTPIVPTPPPSTCDHNSPCYPGVDCRNTPSGPQCGPCLRGYSGNGRVCVK
INPITCLQRPCFLGVRCYDDDDYGYRCDRCPNGYIGDGERCERIRNPCDRHPCHPEVKCH
PTYNPPYFKCGPCPSGYVGNGTVCLDANECELARPCHPGVRCMNLHPGYRCDRCPTGYTG
PMTEGVGVEMARSRKQICQDIDECETNNGGCDPYSECINTEGSYRCGPCRSGYVGNQTTG
CRVQKGACPDLITICDVNAYCIAMYANEFTCKCHVGWTGNGYFCGPDSDNDGIPDNRLNC
NDRRCYTDNCQTVPNSGQEDADGDGIGNACDDDADNDGVLNLTDNCWLIYNSNQLDSDND
KIGDACDNCPMNWNSNQEDIDDDGEGDACDNDLDNDGIPNNQDNCINLKNSNQRDTDGDG
IGDICDNCPNISNADQDDIDGDGVGNVCDTNSDRDRDGVQDDKDNCPDVANPGQNDGDRD
GMGDECDDDIDGDGIPNGSDNCPYVYNLDQRDLNHDGTGDACWNDNDNDTVINTHDNCPN
NSLIWTTDFRKYFTVALDPYGTAQQDPVWRIHHEGAEIQQLLNSDPGMAIGPDELSNADF
EGTFYIDNHDDDDDFAGLIFSYQDNRHFYVVYWKKNAQVYWEPSPFRAEAEPGFVMKLVQ
SDTGPGEMLRNSLWHKEDTPNQVRVLWKEPGISWQPRVSYRWHLLHRPKIGLIRFWLYQG
TQQIVDSGNVFDSTLQGGKLGVYCFSQEMITWSDLLYKCTDTVPQIVWDQLPDNLKREVE
VEISNKYQQQIIQRRMNYDF
Download sequence
Identical sequences F4X8G0
Aech_00978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]