SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01002 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01002
Domain Number 1 Region: 184-312
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.01e-37
Family Dystroglycan, domain 2 0.00095
Further Details:      
 
Domain Number 2 Region: 909-1011
Classification Level Classification E-value
Superfamily Cadherin-like 4.55e-16
Family Dystroglycan, N-terminal domain 0.021
Further Details:      
 
Domain Number 3 Region: 672-767
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000314
Family Dystroglycan, N-terminal domain 0.027
Further Details:      
 
Domain Number 4 Region: 82-172
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000188
Family Dystroglycan, N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_01002
Sequence length 1297
Comment [mRNA] locus=scaffold99:1874990:1882334:- [translate_table: standard]
Sequence
MKKYPYILVCVLLLLPLSLGLSLQEDDLVFDDVGEDNDNDNVPIGSVLINHHTSHGRSDR
YEHGSSSRDGRRHVSRVERAWGVPDSVIPVGHIFRMKIPRQAFSGSVDFYEVHETADRDR
LPQWMHWDDAVSTLLGVPSKKDIGNYHLSVTAVGKHRDTAKDQFVVQVIPENFEELKHKD
GKTHCEDGEDQTILTILLDARMDQLSPTIRVNAIENLAGFLGMHTSAFSMHSQSIKDATT
LDSSVIFTGPGNVRHHKNKESHLTTIQWQVGCDGHLWKHQTELVKQLREQAKDGTLAEVL
QLPVMSWRVRTDLNSFLRNRREAGSGDYGDSDDYGGYDDDYDGDYDEENEEDDNDDNFGV
PPTFIPDLKHPHRHHHGEETIDWKSEDDEQEIIPRMSQSELDNKTTTTTRTTELTTSSPS
TTTTTSTTTTTTTTTTQATPTTVTSTSSTTTTVTSADITATASISTAVAPSIESPRSETT
DEESSTEKTKPVESVESVEPAESVTVLPTIPSDITTTPPPVTTLPPFSTSITQTSVFDKI
ETEIVGITNVTTEESEQTTSMKESTVPTFIVTDVNTTTTTLTPTIVTNVSTSTIIPVVLT
NETITTTMPPTSDLRTTMSSTTPSTTSTTTTTTTTTTTTAAPTTTTTTTTPRITTESIEY
GQVNFPPRRDRRLKKIPVTAGKPLSYVIPADTFTDFEDGNTRNLKLSLYWQGIPLKTTHW
LQFNHHTQEVYGLPLENDISTWNYELVAMDREGANVTDSLDIHVQQHKLSRSVNHEFNIY
LKIDKRIEFPTDIDWELEVIRSLAELYGDSDTQHITVRSININPDREQVMFAWTNDSLPR
SSECPREHINKLLRVLIDSDGDPSASLKAVLAPEIRVKRIIFQGIGQCEDMNHSEIPKVS
TEEPKMNFPPVPRNQVDHVNATVGQLLVFKVPEDTFFDAEDGSSRNMKMSLLTIDRRPIP
PYEWLQFDNKNQEFYGVPMITDIGRKEYQLVVVDKEGASATDGLVVVVHSAPPMAHTVEF
SMTLDISYDSFAHSALQKRNFIEKLRDLYGDRDTSAILLHNISNGSTVITWHNRTLPTSY
CAHDEVNRLRSVLVKSDNDRRSVTDEVLDVMGLKFPVKQITVIPMGICLGELTGVHSPDS
HVPPVDDSTSVGAFHDDYLLTFVLPAIIIAAMLILAGIIACVLHKRRRSGKMSVSEQDDE
RQSFRNKGIPVIFQDELEEKPDPGNKSPVILKEEKPPLPPPEYQKTEDGADVPMLPKENS
EEPYQPPPPFATNRDTNRQNRPKPTPTYRKPPPYVPP
Download sequence
Identical sequences F4X8I3
XP_011067544.1.86870 XP_011067545.1.86870 XP_011067546.1.86870 XP_011067547.1.86870 Aech_01002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]