SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01073 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_01073
Domain Number - Region: 92-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0768
Family EGF-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01073
Sequence length 429
Comment [mRNA] locus=scaffold99:2923023:2924393:+ [translate_table: standard]
Sequence
MQVRLDGKLALLYTLLVLQVLIVMIYVATTPPPELAASTTRASVSFVKFEASQELHVNQG
NRKKSSIYQTINGEVALKDVKTFRLFEVYNHTICWKHGMDQRKTKSNEHLERCICNQGWH
GLDCGQPEVVWRAIMASKQNVSLKHRKIARHIIHTFFISDYNSAIAEVIVEELYNVVDLF
VICDFNNAEDNFRHKLSKGLLQREQKKILYINVATKSHKPSRTVSRYVWDKIKTVVQNLK
DDDIYVTTEPEQILNSRALMFLKVYDGWPQPIGFRLRWSIYGFFWQHPLKTTITLGAYTV
GLMRNAYQSNSLVLRQQLDGDTSERDILGLVIGDLNHYGGWYCNLCQAPANIIIGLRNKV
QSKEIYIEKTIDVPFVEDLIGSGLWLDGKTNLLRVSKSRDSYFAPETILNNTWKYDWLVE
NFYAKLDYY
Download sequence
Identical sequences F4X8P2
Aech_01073 XP_011067621.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]