SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01127 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01127
Domain Number 1 Region: 752-902
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.31e-28
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 260-360
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-24
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 
Domain Number 3 Region: 1221-1369
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.01e-23
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0038
Further Details:      
 
Domain Number 4 Region: 132-244
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-23
Family Spermadhesin, CUB domain 0.00098
Further Details:      
 
Domain Number 5 Region: 2487-2696
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.21e-21
Family Laminin G-like module 0.085
Further Details:      
 
Domain Number 6 Region: 359-476
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-19
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 7 Region: 597-668
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.92e-16
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 8 Region: 973-1038
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 651-715
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 10 Region: 2129-2259
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000424
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 11 Region: 3114-3244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000159
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 12 Region: 2242-2374
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 13 Region: 1984-2026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000447
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 14 Region: 535-599
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000473
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 15 Region: 89-129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000864
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 16 Region: 1811-1963
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000942
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 17 Region: 903-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000683
Family EGF-type module 0.014
Further Details:      
 
Domain Number 18 Region: 2-99
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000212
Family C-type lectin domain 0.0054
Further Details:      
 
Domain Number 19 Region: 2405-2446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000027
Family EGF-type module 0.011
Further Details:      
 
Domain Number 20 Region: 2100-2142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000504
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 474-546
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000403
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 22 Region: 1110-1178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000128
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number 23 Region: 2023-2066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000154
Family EGF-type module 0.013
Further Details:      
 
Domain Number 24 Region: 2372-2413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000191
Family EGF-type module 0.03
Further Details:      
 
Domain Number 25 Region: 2447-2484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000042
Family EGF-type module 0.029
Further Details:      
 
Domain Number 26 Region: 2063-2107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000712
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 27 Region: 710-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000779
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  Aech_01127
Domain Number - Region: 1174-1218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000347
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number - Region: 3045-3094
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00314
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 3300-3337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00681
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 1572-1593,1764-1820
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0335
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number - Region: 3269-3297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0511
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01127
Sequence length 3485
Comment [mRNA] locus=scaffold99:3708584:3731373:- [translate_table: standard]
Sequence
MVVESYSENNMSANMIGRHLDRYWLGLASLDYLRTNTLESAAGMLVSQYAGFWASKQPNP
LSGECVDVALTDNQQTWELTTCESLLPFMCRADACPSGSFHCSNGKCINAAFKCDKQDDC
GDYSDELDCPANCQYYMASSGDVVESPNYPHKYAPLSNCKWTLEGPQGHNILLQFQEFET
EKSFDIVQILVGGRTEEKSVNLATLSGKQDFSNKLFVSASNFMIIKFSSDASVERKGFRA
SWKTEPQACGGILRATPQGQVLISPGYPQNYPGGLECLYILQAQPGRIMSLEIEDLDLEA
NRDYILVRDGDSPMSKPIARLTGKSEDNPTVIISTGNNLYLYFKTSLGDSRRGFSIRFTQ
GCKATIIARNGTVQSPSYGLNDYPNNQECLYKIKNPDRGPLSLKFTNFTVHKTDYVQIYD
GSNTNGLRLHSGSGFTSNTRPKITLTAESGEMLVRFVSDALHSNIGWQAKFSADCPLLQP
GEGALASNRDTAFGTVVTFSCPLGQEFATGKSKISTVCLPGGNWSVMYIPKCQEVYCGPV
PQIDNGFSIGSSNVTYRGLATYQCYAGFAFPSGRPTEKISCLADGRWEKKPSCLASQCAP
LPEAPHANITILNGGGRSYGTIVRFECEPGYVRSGHPVILCMSNGTWSDKVPTCSRAKCP
LLPMIKNGFIVDIGKDYYFGDEVRVQCNKGYKLTGSNIIQCGPYQRFDNVPTCEDINECT
SSQCDLASTECINNPGAFTCKCKSGFAPTMECRPIGDLGLINGGIPDESITVSSSENGYT
KTGIRLNNGDGWCGNNIERGTNWVTIDMKAPTIIRGFRTQVVARIDGNIAYASAVRIQYT
NDLTDVFIDYKNPDGTPVEFRMAEATLSILNLPMPIEARYVRFRIQDYVGAPCIKLEIVG
CTRLECADINECAIRNGGCHQKCINSPGSYSCMCNTGYELYKGNGTAGFNLAKAETGERD
GDLYQRNKTCVPVMCPPLTAPENGKLLSTKEQHHFGDLVRFQCNFGYVLSGSSAVICTSS
GVWNGTIPECQYAKCVSLPDDKSEGLSVIRNDETSVLVPFKQNVTLKCGTNGRYLRNTAT
SNFRQCVYDPKPGLPDYWLSGLQPACPRVDCGNPLPTPGAEYGQFLDTKHHSSFFFGCQD
TFKLAGQTNRNDNVVRCQANGVWDFGNLRCEGPVCEDPGRPSDGYQVARSYEQGSEVQFG
CNRPGYILISPRPIVCIREPECKVIKPLGLASGRIPDSAINATSERPNYEARNVRLNSVT
GWCGKQEAFTYVSVDLGRIYRVKAILVKGVITNDIVGRPTEIRFFYKQAENENYVVYFPN
FNLTMRDPGNYGELAMITLPKYVQARFVILGIVSYMDNACLKFELMGCEEPVTEPLLGYD
YGFSPCVDNEAPVFQNCPQQPIVVQKGANGELLPVNFTVPIAVDNSGSIARVEVKPQSFK
TPIRIFEDTFVKYIAFDYDGNVAICEINITVPDITPPKLSCPQSYVIELIDRQESYPINF
NETRKRINATDASGPVTITFVPERAVIRIGDFENVTVYATDPSGNRAVCHFQVSVQATPC
VDWELKPPANGNLKCIPGDQGMQCRATCKAGYRFTDGSPVKTFGCDVSKRWTPSSMVPDC
VSENTQQADYHVTATVTYRANGVVSEQSCLSNYQKLMAAHYTNLDGILTQRCSAINVNMN
VSFVRSLPYLIEDNVLEMVFILVVVPAQRQTKLYDFCGSTLSLIFDLKVPYASAVIEPLL
NVSAIGNQCPPLRALKSTTSRGFTCSIGEVLNMDTNDVPRCLHCPAGTFAEEKQKLCTAC
PKGFYQNSDRQGSCLRCPFGMYTKEEGSKSIDDCIPVCGYGTYSPTGLVPCLECPRNSYT
GEPPIGGYKDCQTCPAGTFTYQPAAPGRDRCRAKCSPGMYSDTGLAPCAQCPKNFFQPQH
GAITCVECPTNMYTDGSGSVGREECKPVQCTDSVCQHGGLCVPMGHGIHCYCPAGFSGRR
CEIDIDECASQPCYNGATCIDLPQGYRCQCANSYSGINCQEEKSDCTNDTCPERAMCKDE
PGINNYTCLCRSGYTGVDCDITINPCTASGNPCNNGATCVALQQGRYKCDCLPGWEGQSC
EINTNDCAERPCLLGANCTDQIADFSCDCPHGFTGKRCHEKIDLCLGKPCLNGICVDKLF
SHECICHPGWTGAACDTNINECASRPCRNNGQCIDHIDDYACTCEPGYTGKQCQHTIDDC
ASDPCQNGATCIDQLQGFTCRCRPGFVGLQCEAERDECQSDPCNPVGTERCIDLDNTFVC
HCREGYTGSSCEINIDDCASDPCLNGATCRDEIGGFKCICPEGWNGVYCQMDVGMCQNRP
CQNDATCVDLFLDYFCVCPSGTDGKQCETAPERCIGNPCMHHGRCQDFGSGLNCTCSNDY
TGIGCQYEYDACQAGACKNGATCIDEGPGYTCICPPGYTGQTCEEDIIDCKENSCPPSAT
CIDLTGKFFCQCPFNLTGDDCRKSIQVDYDLYFSDQGRSSASQVIPFFTNSAKSLTVAMW
VQFTQRDEGGNFFTLYSVSSAHVPTNRRLMIQAQSNGVHVSLFHDLQDVYLPFREYATIN
DGQWHHIAVVWNGENGGELILITEGLIASKTEGYGSGRSLPAYAWTVLGKPQSENTKSYT
ELGFQGHLTKVQVWGRALHVTNEIQKQVRDCRTEPVLYQGLVLTWAGYDETAGGVERVVP
SHCGQRVCPLGYGGNKCQQLEVDKIPPEVRGCPGDLWVIAQNGSSIVTWDEPQFTDNIGV
VRVQEKNGHRSGQTLMWGTYDISYVAYDQAGNSATCNFKVYVLSDFCLTLKDPVGGTQQC
KDWGSGGQFKVCEISCNTGLRFSQEVPKFYTCGAEGFWRPTSDPSLPLIYPACTRHERPI
ECSKRLENYCVRYVSPTVLCNEAGQGVLKQKVRNAVNSLNRDWNFCSYSYEGTRECKDLH
IDVQCDHRTRTTRETNEEDGGTYVISAVVPAEPTRKGRQGSDTYEVEISFPAINDPILNA
NSNERSTVQMLLERLILEEDQFDVHDILPNTVPDPASLILESDYACPIGQVVMAPDCVPC
AVGTFYDEETQQCVSCPMGTYQNESGQLKCNSCPIIAGRPSVTVGPGARSAADCKERCSA
GKFYDDLGGLCRSCGHGFYQPNEGSFSCQLWDECGSGQQLAVEGKCEPCPRGTYRTQGVQ
ASCQACPLGRTTPNMGSAAIEECSLPVCEPGTFLNGTLNECVECKKGTYQSEPQQTFCIP
CPPNTSTKGSAATNKADCTNPCETSGEEMHCDANAYCLLIPETSDFKCECKPGYNGTGTV
CTDVCLGYCDNEGVCLKDSRGQPSCRCSGSFTGKHCMEKSEFFYITGGIAGGVILIILVV
LLVWMICVRASKKKEPKKMLTPATDQNGSQVNFYYGAPTPYAESIAPSHHSTYAHYYDDE
EDGWEMPNFYNETYMKESLHNGGKMNSLARSNASIYGTKDDLYDRLKRHAYTGKKDKSDS
DSEGQ
Download sequence
Identical sequences F4X8T7
Aech_01127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]