SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01129 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01129
Domain Number 1 Region: 924-1167
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.21e-70
Family Eukaryotic proteases 0.0014
Further Details:      
 
Domain Number 2 Region: 1544-1745
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-17
Family Eukaryotic proteases 0.002
Further Details:      
 
Domain Number 3 Region: 646-688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 4 Region: 1754-1792
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000102
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 1805-1838
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000122
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 1368-1406
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000969
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 1875-1918
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 1302-1338
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 9 Region: 1187-1221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000183
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 10 Region: 716-762
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  Aech_01129
Domain Number - Region: 685-713
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00196
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number - Region: 1344-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0615
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number - Region: 1844-1872
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0982
Family LDL receptor-like module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01129
Sequence length 2023
Comment [mRNA] locus=scaffold99:3790936:3807952:- [translate_table: standard]
Sequence
MTKSSGRSHSNFYARHKHILLIGAISILLIVLFITIINFMFSIMSGHDAHNTSVRIQPEI
RVERVIRLGFPLSRRSLLKSRVGKVIDGDPSFSDQTELTSQITQVVKDDTFLTINGRDAD
TRFKREVSRKRRDCALNDQYCKVLLHTVQDYLVNLNNKFSATNDEKSLPRDILKCLECKQ
ISIANENYTSRLKDRYFPHDYTEQNRSSDFSTTIKLLDDREAENGSKLPEVNQIKAADIQ
LLETDSVIDDPLQNATNQSLKDVISETSTVSINYTNSNGSQRIYVNDTDSNNSDVNVKWS
DRNSVVNNSPVMKSQNNEGISAVSKNDQQQSIITANEGVTSVKPLFLMESSTRMHHDTVT
KDDGKSMKTTIAADSIGTTETRIRTIIDLTKQITENVTSVPVVYDVTGINGNTVHPSAHP
SFEGHPENRSTTATNGSRLKENHRDNKHFMPADHFQIKDNGKPMPVAVKTTKSFQQLQLT
PTTWTMPHPICFFGYPGQFSNMPLSPESAFYSSPSSTQHRGFPFQNPLHQGFSPNYMQIQ
ANTPMSRLNYADSLPQSIAQAIGPTGPAMPNAPIFSLNQQSTAMSQQPIANMPYFCGYMS
LSTVHFPPISDTSQSDRSVGEVKDLPKESQKLPHKVGVITQHNPQYHTLNKCPINYHQCD
NQYCIPRIKWCDGRVDCADASDETRCSCRDRISRNRLCDGYFDCPHGEDELGCFGCPMES
FNCDDWDKRYNSNNCVLLSQRCDGIKHCPNGKDELDCNMLLEHMGSNDIFAVGYTQGYLH
KNVRGQWYPVCSETLSWAVDACESEIGLPLTTMPEIQTVRMSEIFQNLYVIESDNNDIKM
TLCPGTAVFVKCPPLPCGTKVFPRQNLSPAFNTTKNNYMSRRYMEEQSPLKNAEFNKLYQ
ETLRLLKPNQFMSEKKMQKQINDTFVGSQLRVVGGRTSQPRAWPFLVAIYKDGFFHCGGV
ILSEVYILTAGHCMDRYEGHYYEIQAGILRRLSFSPMAQWRKVKYVMVHPNYVKEEMQND
IAVIMLDESLLFNRWVRQVCLPTLNTAGAEWKASPSPQSICIAIGWGSMRENGPDPDHLR
EVEVPILSSCKHSADQNNATICAGYPAGGHDACQGDSGGPLMCRNLNLESQWYAAGLISH
GDGCGRPDEPGVYMKVSYYVDWILQTFKILDNQMASLYENKPLDSCIGFSCHSSIKKCLP
IKNHCDGIVNCLDAEDEIECQILKANYARYGNSNDNFPTFIKSQAKEVSSDTTEKNEVNT
EATPISTSSYFFYQTETQTYNNENSNIVDIYETTPEITMSNVRSTFTCTNLIQTIKINKR
CDKHLDCEDGTDEKDCTCRDYLLNFQPTAICDGHLDCDDETDEKDCGICKNNEFYCSRSG
DCISITKRCDGNFDCSLNEDELDCIALTNGEYVNVDSDNWSILNTEGLLSRYYNGTWHVE
CLQADMLENSTKTSIIGENLCKYLGFTGLQSLDKAVVNKTILETKFSRKWDNTTGDKPLP
QHVAESKGGETCTTLRFRCRPVLSSSADSHVVIDPRTGNHTYLWPWLAAIFVDGRYHCSA
LLLEPNWLLSSSSCTEIIRLSVNYTTALLGQSHSFLYVDGPHQQISIVDEIRDVERTNVS
LLHLKTAVNFTRYVQPLFLEKKIYPPAKSDLCVAIGTDNEYVTQSIFLQPILQNCDKCYR
CFVEALGTKCSTNGTSSNWNGTVFCRSEKGWYPVAVFQENDGPCSFRSMRNLTSIDYIHA
YLTQTLEKVSQPTPEAACDGVRCNIGQCIPWNQVCDGVMDCRDGADEKNAMCLQVQQIRR
RNETNKCAKSEIQCRNGECISKSAFCDGKVDCSNGVDEPVICSCAEYLKLTMPERLCDGV
RHCLDKTDESPEECQCTITSFKCNTESKNHTCISQDFVCDGDNDCPNGEDEMDCRGVQQL
SDDRPAAGEVMQRSYGVWHTLCYPSEITSHEEAVKVCRKNGYTNGIIDYKYQSFNQPAVP
SRDDFYMIRLNSDTWITMRNDKPLITLVPPEKPCYRLFIKCSN
Download sequence
Identical sequences F4X8T9
Aech_01129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]