SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01152 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01152
Domain Number 1 Region: 258-351
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000144
Family Kelch motif 0.019
Further Details:      
 
Domain Number 2 Region: 12-112
Classification Level Classification E-value
Superfamily POZ domain 0.00000022
Family BTB/POZ domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01152
Sequence length 438
Comment [mRNA] locus=scaffold244:187828:195238:+ [translate_table: standard]
Sequence
MENKNEELRETVILILKAERFEVEKQKLISKSQYFAALLSANYLECNQTEHIINYDISQI
SLQDFINWVHNDKIDIPTIHYDIKEFDRLLVLLELSVLFAVDNLIEDVIDRLERYYMSPK
YVINIWLISQDLNINVLRDLSLAVCLDRFDELPISSIYELSRENFLKLLGNINIRSTESY
LFHVTHEWMNHHCDFTIPMDILRNKEIKVLHSIISCESSDIINSKQFIHCWDGNDFFELT
SFKYPKDITDRSTGKNILTGMQIIARGYNLYLCGGEFGIGSGRFNKNVWRYSLISKKWFL
ETVMPIERRHMVTVFLKNKLMLVGGVGRYRQKLQSIDIYDVHTGLNIWINIYFPDENIWE
TKMGFNMDYSRQSSPFMPILTLKTLPCYIDINNPDKIVLRTITETCMEISCTDHVQGIEH
LVFENENDSNQREREAYR
Download sequence
Identical sequences F4WFV0
Aech_01152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]