SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01191 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01191
Domain Number 1 Region: 47-191
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.12e-31
Family Fucose binding lectin 0.00041
Further Details:      
 
Domain Number 2 Region: 201-344
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-26
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 3 Region: 343-411
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.05e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 636-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.95e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 578-647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.07e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 461-528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-16
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 7 Region: 779-843
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 8 Region: 518-589
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 9 Region: 394-458
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 10 Region: 838-907
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000987
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 11 Region: 730-789
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 12 Region: 891-954
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000031
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 13 Region: 2-49
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000153
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_01191
Sequence length 1086
Comment [mRNA] locus=scaffold244:617025:634963:- [translate_table: standard]
Sequence
MNAKVSLSDESLISGTIAKYTCDAGYELFGIGSLVCSPRGKWQGDLPFCGTNVGFRKPAN
QSTTVRGGNANHGNDGDFGTEHDGKRCTETQSEPSPWWRVDLLKSYSVKVVRVTTRGCCG
HQPLQDIEIRVGNSSAELQRNPLCAWFPGTIEEGITKTFICARALVGQYVFLQLVGVEGS
LSLCEVEVFATDEFSIDRCAYANTPADADLTAFNSTCYEFMVKKGGSFEEARNYCKGRGG
DLVHGFKGISSVFILNNLEKRKDKLKTQLVWIGAQKEPQITVRTWRWVDGEIVQKPSWGK
DQPNNYNGEQNCVVLDGGRGWLWNDVGCNLDYLHWICQSKPPTCGSPEKSENTIIVGSKR
MIGSTIDYVCPDGYMLIGSKNRMCESSGSWSGDVPTCKFVDCGTLPNLENGAITLLDNRT
TYGAFADYKCKENFTLKGDTRRRCGDGGIWSGHEPQCLFDWCPEPPEVNGSIVTTNGKRA
GSTATYSCQNGFILFGDNVLTCNVGGEWSGKAPQCRFVDCGAPAQIEFGTVVLINGTTTV
NSLAVYTCQQDYWLVGEGKQECTKEGKWSHDTPSCELITCEEPEVPTGGYVVGYDLNVHS
VIEYHCDVGYLLHGEARHSCGKDGEWTGEVPICEYVNCGKVLPILNGAVDYANDTTHLGS
EITYSCTRNYRLNGISRRYCLDNGQWSDATPKCEEIRCPEPVLAEHGILSVTGNDRMYGR
TLIRTGTAENSNTGATSYKIGALAKYRCERGYKVVGEPLSTCEENGKWSGEVPQCVYVDC
GKPEHIQHGHYTLTSNATYYGAAALYECDGNFELDGFARRLCLENGTWSSDTPVCKEIRC
RDPEKIGVLSTQVSTHSVGGVAHYSCPRGFYMEGNETRICLQSGSWSGTTPACFSVDCKH
PGPIENGRVIVVNGSTTYGGAAEYHCLPQYERIGIFLRKCLDTGYWSSEEPKCELATNEI
AEPQGVGTSVGIGAGVIIFILIILGLIYLRLRKATPVKNTENVQAAERKEDQNAAVMSYA
TLNDGTHNSMYENVPEDGLYDNPYSLSGNAYRYGGHSRRMYGRSGHYEAEPVSNRNGITI
NGVSVR
Download sequence
Identical sequences F4WFY7
Aech_01191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]