SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01226 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_01226
Domain Number - Region: 524-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01226
Sequence length 774
Comment [mRNA] locus=scaffold244:1384053:1393119:+ [translate_table: standard]
Sequence
MSSFELEGFSFEDSSCAIFRNFIQHSGNTQLFQSDGHLPYVARHRNMRESALAVLLAWTL
AAQQGLCGKLEKIAQQPSNVLVDYYAYRHISIIHFNVPERTVAVAFKFTAKEEKTGGIGR
CTPLNISLYLKSASLPFVCPDGSKVAAKLIEKKKRRRQYSLEMQSDGEQYIIKIEAPSAG
DWYAIAFRSWTDPEDGKIKQQGLSASCETIMDAEMFVEMPATTSLVDSEIEYKVQLDETS
DTAIVQYLVPDVGLEELSLFLKSSCGEDCNIVVYVTAEDNLADGLLNSTAMSLPFKPYVD
NFHFVTLRLLSGNASNVTMQLPMSHQTDIGIDQVTPVVLSRKSFPEFFLFDYEHLLGNDT
KPQPFNVTAEALSVLSFEIGRVYDVGGTVTLGFKLIDVEEKYKKNIVLVACVSLGYYTNI
TSGGGCVRARSLTTADMYVNATEPAYMHVPFPEAGTWYVSLRVFCPEEEKEGAEEKTLNG
ANINISTSSCSCSRTCLQGDVVCETCDCLPRCPAVRVESIVSSSPCIEGRCGHRGKCMHY
MSGGFVFSACYCTGGYRGFDCADNTYVLSTSGILLQLLALTFSNFAFLGSIYVAVKREYF
TEAVAYVAVMFFSTFYHACEAGEEVYSMCIMRLSVLQFCDFFNALLAIWVTLVAMASFGP
RLTAFCQVAGAIVLAMGAEMDRTALWVFLLPAVTGSALIGLSWGLRCKRKRTIRYPSRPY
RTIYFPAGVLLVTLGLVCYAFLQTRRNYYLIHSLWHICVAIGVILLLPKRKYMK
Download sequence
Identical sequences F4WG19
Aech_01226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]