SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01434 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01434
Domain Number 1 Region: 189-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000114
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 2 Region: 66-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000903
Family Spermadhesin, CUB domain 0.007
Further Details:      
 
Weak hits

Sequence:  Aech_01434
Domain Number - Region: 300-346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000379
Family Spermadhesin, CUB domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_01434
Sequence length 562
Comment [mRNA] locus=scaffold35:425050:433346:+ [translate_table: standard]
Sequence
VIFPTFWWILTTTANIIRNDDICGSYNGRRLYLELDERSILYAKNVTFVKNLSRQLVPRP
YATTINSSHYHCSLELVTCPSCVIVLTFKNIALPNNCDGGIVMDSPCRCDYVWLSEPPYE
EVSGTPFCGLYAPITYRSSTRTLSITLFYNQSHRHAFTIEYMAEKNRLHLKGTEMTSRAS
TKGLNGTGGGVLMSPFFPARYPPDLGLEYIITCPSEIPSCRIRLLFSDFQLATVSIIEFY
DWNGQRLDVSSGARFRPPVIVSSGSSLLIRFYANGGTGLGYKAFYSFVIGHTYDKSVQPI
TDCGGYVENLGGTITMMNMVGRGVKIYDCVWLIRPPKNFLHMKTHIYLKVVSFAGMDGTR
IDEISIPDDPPGYEAPPDYEEVAKLALSKKTQCLKCDRTFNRNFSNQHEVANSSTYLVME
GSSNDHSNQTTPITSENNQRALRIPESPPPPYITPPGTILRNIANLSTSMKQICPVRLRC
SARYPQASSSNRPPSNGPSLFMNAETLDTYQTDCIASGTNQQFQNLPKDRIVREVVEEDT
TVALQENNGHVSEEDYEELVNK
Download sequence
Identical sequences F4WNZ5
Aech_01434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]