SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01436 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01436
Domain Number 1 Region: 364-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 443-481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 403-439
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 492-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000511
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01436
Sequence length 585
Comment [mRNA] locus=scaffold35:456175:474314:- [translate_table: standard]
Sequence
MRTPQVKRRIDSIWRSYVISKAEIMHGSRVTILILCTMMNCLRLASSSPTSTNVKLGDEC
NQDRECEIGIANSHCYLGYCRCQPFFAGYNGTHCLESTLLGNDCLVKEQCSLKVANSSCL
ENVCRCEEGHLQFRRHTCLGPAKLGEVCYEHAHCRLWDPESHCDFLIPDLFGRCQCTAPM
RREGDVCRPDSLVRPAPLPQHLPPTQDPIVEDVTEIEHNKETITDGQKNEEEQDTGVQIS
WLKNASMLLSTEPPNQLIPVNLVTRPSSLRPGFNNRPGPNELPDDDDTVVIEAEVTEPAH
VTTTTFVPIKTDRHESTIMTAISLGLPCVADLECRMADQMSRCIGGVCDCSFSTNSSCNA
RRTGCAPGTFQCRSSGSCISWFFVCDGRTDCADGSDEECTGLRCPVQAFRCNDSNVCISR
SGVCDGNRDCPRGEDEIGCNNRRKCPEGTFRCNNGQCLPAYEFCNAVVSCRDGSDEPKAA
CRTRNRGRITARYCPFRCDNGRCRSDAITCSGRDGCGDGSDEKRCNVCNNDDSMHQKAVV
RSVRFLEPNAKSRSRVIRAGCIDYVTIFHNNLYTHPEEYSKKLHK
Download sequence
Identical sequences F4WNZ7
Aech_01436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]