SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01651 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01651
Domain Number 1 Region: 805-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 2 Region: 757-807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000865
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 323-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 4 Region: 1063-1111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 5 Region: 960-1007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.0018
Further Details:      
 
Domain Number 6 Region: 497-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family Laminin-type module 0.0054
Further Details:      
 
Domain Number 7 Region: 911-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000273
Family Laminin-type module 0.055
Further Details:      
 
Domain Number 8 Region: 851-892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 9 Region: 1012-1061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.0021
Further Details:      
 
Domain Number 10 Region: 260-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.073
Further Details:      
 
Domain Number 11 Region: 402-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 12 Region: 1111-1158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000181
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 13 Region: 446-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.0051
Further Details:      
 
Weak hits

Sequence:  Aech_01651
Domain Number - Region: 86-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00105
Family N-terminal domain of xrcc1 0.077
Further Details:      
 
Domain Number - Region: 1404-1481
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0102
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 
Domain Number - Region: 1197-1352
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0759
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_01651
Sequence length 1757
Comment [mRNA] locus=scaffold7:410410:418812:+ [translate_table: standard]
Sequence
MSPMDVVTERHNRLGPIIPTSRGSHAKRPHPCEQSSCYPATGNLLIGRKDKLTASSTCGL
HGPERFCIVSHLKDRKKCFFCDASIPKQQHNIENIVSGSWWQAENGVENVTIRFDLEAEF
HFTHIIIRFQTFRPAAMLIERSYDFGKTWQVYRYFAHNCEHYFPDIPTHQPQRLTDVICE
TRYSAVAPSTGGDVIFRVLPRNLEIDNPYSKEVQNLLKITNLRIIMTRLHTLGDDLLDDR
AEIREKYYYAIQDMVIRGSCSCYGHASRCLPLPGVSDEENMVHGRCECTHNTKGLNCESC
EDFYNDLPWKPAVGKQTNACRPCNCNNHTNSCHFDETVYERSGRVSGGVCDDCQHNTRGQ
NCEQCKPFYYHDVTKDISDPEACQPCDCDLNGSLDDGICDSRTDPLSGDESGRCHCKVNV
DGRRCDRCKNGFWNYDPDNPEGCQACTCNILGTIDNQGCNVVTGECTCKRYVTARDCNQC
LPEYWGLSEDRDGCKPCDCDPGGSYENSCDVITGQCRCRPHVSGRTCNQPEQSYYTGSLD
FLIYEGELSRATDNCQVVIREPYRDGRNSTWTGTGFMKALEGSVLNFTIDDIRRSTWYDV
IVRYEPVHPGVWEDVQVILERDSLPDPNGPCADWKPEYDRLWVQLPLRSRSAVAQPSVCL
EAGKRYNLLLQFRKFNSHVDTPLASILVDSIVLKPRIDVIPFFKAPGLGELRRQEYERYH
CNEIYNDVNSVWNNVPDICRKYQNSIGYYVFDGAHSCECNPTGSRSLLCKNYGGMCPCKP
NVVGRRCDRCAPGTYGFGPEGCIPCDCDGVGALDNFCDVETGRCKCRPNTYGRTCGQCEP
GFWNFPHCQRCECHGHADSCDSKTGACINCRDFTTGHNCDRCVDDFYGDPRIGVDIPCRA
CPCPGTRESGHSYANSCSLDSITQDVVCECFEGYSGPRCEHCAENYFGNPEIPGGSCQLC
NCNNNTDLRRVGNCDPHTGHCLQCLFNTDGYTCEVCKAGFYGDALRQDCQDCRCNVLGTD
KTAGSCDHRTGQCPCLPHVIGQLCDACEENHWRIASGQGCDPCECDVVGSISDRCNPYDG
TCECKPGFGGRRCNECQTNFWGNPNVECYPCECDVIGSASQQCDRETGVCVCHKGIGGEK
CDQCDRGYHGDAPQCSPCGECFDNWDLILDGLRNKTYAVIQEASRIQKVGTTGVYSQEFD
DMEESLNEIQDLISNTTIRSQDLDALDNLAEELAKNISESAKQLDEANNHLENLSQRVNL
GDVALKKLRNRTNSLHEAAADLRENATRLQEENVLGALNVTQQMAEQSRQAEKMANDSTN
VLGDAERFRKHTENLLAKNRASVDEAQERNKESLTKLNEKLKTFHMAVPELNLRMCGDNV
TECSSVCGGAGCGTCGGLSCDVGAVSKANQALDVAKQQAAKIKSHKDNAEQLLRNMSQIK
QDATAARSNAQDAFNIAWEAQSFFEKLAKNMANMIKQMLSTQDEDQPTPAMVRALAYAIL
ARNIQLEPDQIAQLADRIEDMVGSLTDSEKILADTKDDLRLAHDLEERANQIKSTAIEKQ
VLANKMILLLNDAQKAQHLAQDAIDKAEADVSKSQKDLADIADVTKAAQIQANSTTQTVE
ALDARLKQLQTQSAKNSFVLTEIGTEAKKVADEAQAIDGKTKKLSEEYKRADESLNQRVN
KTKGDIQRAKRLLTRASELTADTSTKSKDLDGMESVYKENERLLKELMSDVDVLMMEMER
NMAEIEKKSQLYRQCSA
Download sequence
Identical sequences F4X3L2
Aech_01651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]