SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01709 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01709
Domain Number 1 Region: 93-237
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.38e-28
Family Laminin G-like module 0.0087
Further Details:      
 
Domain Number 2 Region: 506-608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000011
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 291-351
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000806
Family VWC domain 0.0084
Further Details:      
 
Domain Number 4 Region: 353-417
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000607
Family VWC domain 0.061
Further Details:      
 
Domain Number 5 Region: 735-791
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000617
Family VWC domain 0.013
Further Details:      
 
Domain Number 6 Region: 454-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000318
Family EGF-type module 0.021
Further Details:      
 
Domain Number 7 Region: 620-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000127
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 664-726
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000429
Family VWC domain 0.0045
Further Details:      
 
Domain Number 9 Region: 417-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000124
Family EGF-type module 0.05
Further Details:      
 
Domain Number 10 Region: 809-845
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000596
Family Fibronectin type I module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01709
Sequence length 1098
Comment [mRNA] locus=scaffold7:1479372:1494516:- [translate_table: standard]
Sequence
MVASRALNSRQTAFRKVQPYLKAARMELENTRKYLKELERIEYARYTDSYEKSAVLNIQL
RIAEPSQPSCRTDHCVLLLPGEERELRLNEENFERAAALLRRVPEFTIAAALRQEEANSG
TIVAFAHGNNRYLELQSSGRKDELRLHYVSRRDGTVHVEAFPFRLADGAWHRVALSISGS
QVELLVDCHPLYRRLLRPGPPDTNFTLPQLQLWVGQRNVRHFLFKGALQDVKLIAGPHGY
LSQCPQLDSSCPTCGQFSILQNTVEQLMHNLNELTRRLAAAEGRINKVEECECQKSCRVN
GTIHDDGESWSKGCQHCSCLHGEVECKPTFCTPVTCKNPIIPEGQCCPICLRQCYLHGVI
YDHGERVSPKQCVECNCYDGSFTCTRIDTDTKCPPLPCPPSEQLSVAEECCKFCPGVDYC
AKGHKCHTNASCLNLQTTYACHCDIGFQGDGLNCHDVDECKQQGGSNGHYCNANTKCVNV
IGSYTCECLPGYYRMDKFNCAELDECATGQHLCDEHATCVNTNGSYYCICKDGYTGDGFT
CKPVCNQTCQNGGECVTPGRCSCRRGYIGNSCELDLDECASDLHRCHQSSTCFNMPGWYY
CRCKPGYRSALHESTQGTQCIDIDECNDLTIERRHTCHPTAKCVNTEGGYECVCPPAKDL
EESGKECRLSCWFEDREVTNGDTLAPSGNPCRRCTCQDGVITCKDPVCDCSAPGSHRDKC
CPQCNPAASCRHQELHHLVFRSGERWIYQCQTCECLYGEIDCWQMECPPVTCSNPVTEEG
DCCPRCEDDPCAREALVNSTSFTVPSRPRPCSYAGIIHDSGSSWQDPHDKCTTCECKDGQ
LCCSYDYGCAGDLGNDKQQRSSIAVPEPLIRHPPDHAVQSLVNGAPEAALPAAVTGTPGT
TRTITTSSIASTTSPVSSPSHYSSSSSISNDNPHNLRQDHATGSHILSRVQQRDMAYHAI
RSQQYQQQASTTRHQQFIAGSTTSSTASERSAVPSTTTTTTTTTTTTRTPPATSIGGRPT
LLRRGQSSNIINHHSGAASTFSSSSSSSSSTLSVVLATSTIEEPALPPASIPVQSSIRQL
VGRRRKDSRKSIVLDSAT
Download sequence
Identical sequences F4X3Q7
Aech_01709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]