SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01761 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01761
Domain Number 1 Region: 192-459
Classification Level Classification E-value
Superfamily NHL repeat 5.89e-35
Family NHL repeat 0.00000000012
Further Details:      
 
Weak hits

Sequence:  Aech_01761
Domain Number - Region: 41-113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0628
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_01761
Sequence length 466
Comment [mRNA] locus=scaffold7:2658324:2660763:+ [translate_table: standard]
Sequence
MASPTPSLESRANSLGSPVSLSPVTVSGSSPPASDSAICDVDSCDLCLDAPKSGEDPCPR
CRLGSTGGTSRIRCTGCKSTEAGAVARCYDCDQFLCPNCVMAHQYMLCFEGHRLLNLADS
KLETVGSGGGGGGGRWWQDSGYQRHRKQQQRWQRREAVATNAAPGDSVLDLTSKLMSATA
IFPPKSQIKRQKMIYHCKFGEFGVMEGQFTEPSGVAVNAQNDIIVADTNNHRIQIFDKEG
RFKFQFGECGKRDGQLLYPNRVAVVKTSGDIIVTERSPTHQIQIYNQYGQFVRKFGANIL
QHPRGVTVDSKGRIVVVECKVMRVIIFDQTGNVLQKFGCSKHLEFPNGVVVNDKQEIFIS
DNRAHCVKVFNYEGSYLRQIGGEGITNYPIGVGINTHGEILIADNHNNFNLTIFTQDGQL
VSALESKVKHAQCFDVALMDDGSVVLASKDYRLYIYRYVQVPPIGM
Download sequence
Identical sequences F4X3V4
Aech_01761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]