SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01806 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01806
Domain Number 1 Region: 61-164
Classification Level Classification E-value
Superfamily L domain-like 4.76e-19
Family Internalin LRR domain 0.081
Further Details:      
 
Weak hits

Sequence:  Aech_01806
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00757
Family LDL receptor-like module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01806
Sequence length 177
Comment [mRNA] locus=scaffold7:3924127:3925736:+ [translate_table: standard]
Sequence
MPQRSWCNGVPDCPHSDDESTENCFDMHGNWDWFMKERNWGNSNNCDTFDAPVNCTYDAC
RATCTNFTDVPKNLSSDVTAIFLTDNLLTHLSHDALSRYPEIRLLYLDNNNIIKLDKGVF
LHQSKLFWLILTNNSISEILPGHLTGLDKLETLLLDQNKIVTADFSDLEDSTTTYLM
Download sequence
Identical sequences F4X3Z1
Aech_01806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]