SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01895 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01895
Domain Number 1 Region: 1037-1361
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.92e-64
Family Complement components 0.0000695
Further Details:      
 
Domain Number 2 Region: 1446-1569
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.84e-27
Family Alpha-macroglobulin receptor domain 0.0012
Further Details:      
 
Domain Number 3 Region: 747-778
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_01895
Sequence length 1633
Comment [mRNA] locus=scaffold88:498023:503386:+ [translate_table: standard]
Sequence
MLVWILLLFLASGNGQFTQEPTESTPRLPWNRYDERDQNTGFGFRNPVGQNENVIIKDST
YFVVASRMVRPDQVYRLAVNILHSPLPMMVRTSIQRNGVEIAADHQEVKEGIPETLMMRM
PPTSVDGDYKLRIEGLFNSLTGGQAFLNETKLIFSQRSMTIFIQLDKPVYMQSDTVRFRT
IPIDTELKAYDNPVDVYMLDPNRRIMRRWLSRQSNLGTVSLSYQLSDQPVFGDWIVQVIA
QNQVEEKTFLVEEYYQTRFEVNVTMPAFFFDNDPYIYGIVQANYTSGAPVRGNLTLKASF
KPLDRIRNPSAAIEPVERYFNFNEYYPSWFRILNFYEERVPVLRFFNGTYHFQYPMQELL
GFASSIDGIEVTVVATVGERFLDEVIVGFSKARIFNSTTKINFLGGSPQVFKPAMPFTLN
LVASFHDNSPLRPTQLRDAMMEIRADIEMRSGGRRNIDIQYPKASLERADAWVVKMDLRK
ELGLDSDRASQILDDITSMKVHAHFTDGEGYRAQTELLLLAHESPNMKHIKISTSTENPK
VGQYMIFHVQTNFYIDVFNYLIMSKGTILLTGEDNMQHNIETFAIPLSPEMAPIATAVVY
YVNRHGEVVADSLTFPVNGISRNNFTVFINNKKARTGERVEVAIYGEPGAYVALSGIDRS
FYTMQAGNELSYANVISKMAHFDEQTNGTYTHTWQYHDGDPDEMIYFPSSTFGIDVNRTF
DYIGLVVFTDAVLYRRPDLCNRTQGFGECLTGRCYRLEKKCDGVFDCEDGTDEARCVERN
ATDLAQFRKDRFNRIQRHYENVWLWKDINIGPHGRQIFNLDVPRRPVHWMVTAFSMSPSI
GFGMLPKTLKYTGVLPFYINVEMPAHSRQGEQIGIRVSVFNYMHYNIEATVVLSGSKDYK
FIHVEDNGIVQSYKPRTSFGEHQFFIWIPAQDVNIVYLPIVPVRLGDIKIHVYATTLIGK
DSVTRNLHVEADGVPQYRHQAILLDLSNRAYIQEYLHVNVTETPIITYDENRYYVFGSNK
ATVSLVGDVVGPIFPTMPVNATSLMNLPMDCAEQNMFSFAVNMYTTLYMRLINQRNRTQE
KESFYYMNIGYQKQLSFMNPDGSFSFFRTDWNQSMPSVWLTAFCARIFQEASFYEWENYL
YIDPEVISQAISWILKHQTPEGAFYEVTWLPDRKMNSSLNYKNDIIAYRNISLTAHVLIT
LQSVKDLTGGLGSQVALSAANAIKWLERNLKLLEQRGKPYEIAIVAYALLVAKASTAEQA
YNILAKNERIEGEYRYWGREHVPSPPSKIENQKTFRLPRLPFNYDSENIETTSYALLVYV
ARQELMLEPIVKWLNVQRLTNSGWASTQDTVWATKALMEYTVRSRIRDVSSLSVDIEFSS
MDNKTKTLIVNHKNLAKLQTIEVPQAWGIVKVQAKGAGYAILQMHVQYNVDIKKFQIEPP
IKAFDLVTRANFHGRNQSHISYLCCQRWTNLNESMRSGMAVLDVAVPTGYIIQQQTLDRY
ILSKQVRNLQRARFQERKVLFYFDYLDNEETCVNFTMERWYPVANMSRYLSIRVYDYYAP
ERFNESIFDALPTYTLNICEVCGSSQCPYCPIYNAAMLLSTPTGFLLIASLIVTITRYFR
TQQFDDLLTACSI
Download sequence
Identical sequences F4X6P9
XP_011066460.1.86870 Aech_01895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]