SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01992 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01992
Domain Number 1 Region: 353-598
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.63e-54
Family Eukaryotic proteases 0.0016
Further Details:      
 
Domain Number 2 Region: 135-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 52-92
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 21-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number 5 Region: 99-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 6 Region: 193-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000109
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 7 Region: 262-301
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000097
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01992
Sequence length 746
Comment [mRNA] locus=scaffold88:1912839:1931897:+ [translate_table: standard]
Sequence
AGFSRIHIIAEENSQVYSSLTFICVDGTVMPLTNVCDGIPHCPDSSDEVGTLCRHVVCPT
YMYKCNYGACVSRIARCNGLVDCIDASDEIACDRSVDDICSDRDFQCSTVYQECIPFAEV
CNGYKDCSDGSDENETFCREYACPEHTFRCSYGGCVHQEVVCDGVKDCVDGTDEDSSMCT
AVNCEDHECSQCRCPENWFRCAYGGCIRSELKCNSQLNCHDWSDEDESLCGITLPEGACR
LPAAKAGTHYNVSGCSRCRPGEVVPELTRLDYVCDVEGSLQGASEIYCQNNRWFPNVPSC
TFKNETEGITCPAPFGAHHAIRQCEAMWGPHKGWLSCDQALPVGTRVFLDSAALIVKGWS
VEKEETLPWQATLFSHEDGQWSFFCGGTLIAERVVLTAGHCVWKTAADTIRVAFGILSSD
LNQIGENAQVIDVESIELQNAYQDHESNYGSDIALLILKKAVIINTVVGPVCIPRNSDAI
LLEYQRNSGFGLVAGMGLTENDTFSSVLRVTTVKIISDDECRKNQNRDFRKYLTYTSFCA
GWANGTGVCNGDSGGGLVLQRPNSSVWEIHGVVSVSPRKLGTNVCDPNFYAVFTKVYLTF
NVCCHFTIEIAITIQGCLQLLYRINGNVSFPRLRLVPQRIDIKRLRIGAIQTHQITATNV
GTTLLKLQVLLEEYPEFHVSLSANDESSTIDTYIELRLIKWLMRSDIDSAALEFVHVFNT
TVTYKVTISDKSSPLILPERFTIQGK
Download sequence
Identical sequences F4X6Y0
Aech_01992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]