SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02288 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02288
Domain Number 1 Region: 834-1057
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.23e-21
Family Laminin G-like module 0.0058
Further Details:      
 
Domain Number 2 Region: 258-277,596-765
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-17
Family Laminin G-like module 0.047
Further Details:      
 
Domain Number 3 Region: 43-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000107
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 4 Region: 775-850,1052-1088
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000643
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 157-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 6 Region: 82-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 196-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000653
Family EGF-type module 0.021
Further Details:      
 
Domain Number 8 Region: 120-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000911
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 8-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000657
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_02288
Sequence length 1092
Comment [mRNA] locus=scaffold89:426073:432013:+ [translate_table: standard]
Sequence
MVFALGSDCSGDPCMYGICLDNENSTYSCYCIDGYTGINCEINWDECWSDPCLNGGTCND
GVAAYNCTCPDGFVGANCEQRYSECSNHPCLNNGTCVDYDGITCQCLDGYSGEYCEIDAS
VCNETMCKNSGECIEGPGFSFYCRCRKGWTGVLCEVDVDECLESPCRNGGLCINIPSSYT
CACLFGFTGKDCDKAIVPCKENPCQNGAVCLLEDDRSVCYCVPDYHGVFCELRYDDCESK
FAQCDNGGTCIDGINSFTCACPPNYGGSMCEYSFPSTTTLEMEDTSEQGTSLIGTTTAIV
SPEESTSLVDTSLSSPSLSSPSTISFATYSTSPRTSSSPYTKRYTIMEKTTTSKYEDSSV
SSVFLTEVPSTSSTRDDFVTLEPVTISSITVTEGYLHETETEVYLPTGRSIHDGEITKEP
DDYGQTTKIRLPVSSRIDDVTEYMTSSSYRPTIDEGQKDNRTSVTSAIMDHATNVTLPID
TTFRYTTDSIQNRTFEFGTTIMDTPRTVVPLTTSSTLPSVLSSTIKLDTSTVPSSLTSTS
ISSLSQTTVTSIEVNTTEIGACRGTQCSTSTTVITPRNITEYADGCKTDSTITQAAFNGK
SFVRQRVEVIMTENKNATLRIYVKLKTAFKNGIILHVYFDNERYSLVYLELGSLKFQFSC
GLETMLLGEIDAIIDNGYEVGIDMSFQYVANDENEKCFAKLLVNGTMAVTGEQILPQRGM
VPKYANLYIGGIPLTFSHYFPHVAMGFIGCMDSLKINGIMRHFIHDSIETFQIEECTSFL
CLSNPCQNFGACEESDGRIRCKCIAGYTGPLCEHSACNDNPCSMGATCVSSPGTGFICVC
PLGSRGLFCEEDAILVRPAFSVLVPGFASYIAYGVSTSIKDTMELKLRLIPRTFDQISLI
AYFGQRSSRRDVSDHLSITFVRGYIMLTWDLGSGVRRIFTSDSLTSLSVTGSVGKSKTYT
LRIGRRGKEAWLAVEGLKNVTGQAVGSMTQLDVSPVLYIGGYKSKNFETLPHDLPLHTGF
SGCIFDVELRTDTTILPLTGSSPATGRGVGECNRNECIRHSCKNGAVCLHHGASYSCICT
KEWVGPDCSIPI
Download sequence
Identical sequences F4X762
Aech_02288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]