SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02357 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_02357
Domain Number - Region: 791-916
Classification Level Classification E-value
Superfamily CBD9-like 0.000165
Family Cytochrome domain of cellobiose dehydrogenase 0.011
Further Details:      
 
Domain Number - Region: 171-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00185
Family Integrin beta EGF-like domains 0.063
Further Details:      
 
Domain Number - Region: 183-236
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0628
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_02357
Sequence length 1267
Comment [mRNA] locus=scaffold89:1427978:1451172:+ [translate_table: standard]
Sequence
MSLRTERSTLLASFLMTLLMTLITMTFWRIAHAHVALTFPPARHYDLDFLDNARTPAPCG
MPRGHVKTSLLAGSKFNVTWHLAYPHRGGFRLQILDFYDRPLIDLTPITKNSEFVEGDAT
AQRYPVQLPQDFTCTDCTIRLLREAEEWGSSYRFWSCADIDIRDRMHYKENCSGHGRSLA
GKCRCDRLYHGPRCEIKEECVDNTDCGILGTCVDHGGTTVPTKQCYCDAGWFGPGCAKMR
ASTGIHQTEKKVIKKISDRSERCLNEFAVKPSVTIVLTLSIIPLSGSPVRSIDVNLDVYS
MKRFSDDIIFYWRILKESKELEGVLDIFPEPLPQPEPKSEPVDKSTPKPEPESKPEPGVE
GEKSIAKRRSAKADAASFGVTSPPDVDVTVQTSVTYQVSTKQGRKRRSPKSSAASALGKQ
VGESSSIEETTSESEPTSEPEPKSEPEPSSEPEPKSEPEPSSEPEPSSEPEPSSEPEPKS
EPVPNTEPEPKSEPEPSSEPEPKSEPEPISEPEPKSEPEPKSEPEPKSEPEPKSEPEPKS
EPEPKSEPEPSSEPEPKSEPEPNSVPEPKSEPEPKSEPEPSSEPEPSVGPKSGATKASLP
APGHKYTPKHDFNPMDCTDIIIGTARGTSYRIGDYYTRDRSTPRKDAYWDENGRDSLTAA
FGYERDGVTTILFRRKLAANEPTDHEIRDGNMQVIWAKGQEPGKYIHQPASGIEKAKVGV
KDFYKVDELKYHGHGMQRGAVTMNFFDEVKRPEFAGGVVSQDGICGGQWRYPRNCSPENN
TCEYAIQWTYKDKTDLITFVISTTNTNTWTGVGFSDDNNMSQTDAILGWVDKTNGRAFVM
DTWISGYNAPLLDPSQDVYNISGRIENGVTTLQFSRKRVTKDVKDFSFTDDHCLYMMFPV
KGGIFNPINKKIRKHDVKPVVSSDRICIKSCGQEEIEDQSTYPPPRFNYDVEVKLVSLGD
GFVIPESDSPDFELISNKISESFEPVFKMLPGYYHVYLNELRKDNERGVIARMNLIIDRA
EIKGRSLKPADTGLEAEKALREAVVTGQVGILGVDPQYLVVRTPRVNDIQTEDENDRPPS
ATDLFLGATKFYIVVGCVAALLALALLQASCTIYRSSRKRATKERLIASNAWKDYASGAN
TNFAFEAFETEEKAPPPPISSLPRTREMTSNGMTGMNGTDAVEGPNRIVGPRATYSLPRA
PGARHSAPIQHGYYTQDRRDHYGRPKSMHNPGIATQANQPDFYFMPSQRKYSGEVVRVYV
DYNNQPK
Download sequence
Identical sequences F4X7B6
Aech_02357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]