SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02365 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02365
Domain Number 1 Region: 219-293
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000000366
Family Kelch motif 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_02365
Sequence length 308
Comment [mRNA] locus=scaffold89:1538677:1541831:+ [translate_table: standard]
Sequence
LLLQDFVDWIHNDKVDIFTNCWDIKKCDRLSILVELSILFAVNNLIEYLIYKIEEKLYFM
PPEYVINLWLLSQELGLNILRDVSFAFCLDRFADLPLNSIYELSKENFLKLIGNINITST
KSYLRKVTKKWMDYHNDFTIPLDILKNKETKILHSIVSCENRYYNSSLIVVDNNTEQFIH
CWDGNDFFELTSFKYPQDILNNCNSYYEIVGMEIIGRRYNIYFCGGKFDYEIFNKNIWRY
SLISKKWFLETTMPTERWCMTAAFVKNKLILVGGFGKSYEYPENVDIYDIYTGDFVIQLY
NTHFINTI
Download sequence
Identical sequences F4X7C3
Aech_02365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]