SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02371 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02371
Domain Number 1 Region: 398-639
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.71e-40
Family Eukaryotic proteases 0.0006
Further Details:      
 
Domain Number 2 Region: 105-223
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.16e-28
Family Frizzled cysteine-rich domain 0.0013
Further Details:      
 
Domain Number 3 Region: 254-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  Aech_02371
Domain Number - Region: 234-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000314
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_02371
Sequence length 639
Comment [mRNA] locus=scaffold89:1603299:1611225:- [translate_table: standard]
Sequence
MQRTHEKRYNHRRRYYPAKRVEGRDLVVHFDVKFDPRYQTITTGNIVDILSRELNPETSR
YLTNLTIEAKSLEVQESLKALNAQNSPQSTVSTLPPTTTAPPPRRCSKLDLSYCKHLPYN
ISSYPNMLGHGSLSDVEEDVIAFRELVDAECYPLAYDFVCQVLQPACRASQPEDLLELPC
RSFCREFWNGCGSRLPEKIKRALDCSNFPEYTGPGSCRPKPGCVQALQSKALSSRICDGV
IDCPDLSDEKNCAYCRDGYMHCGVGRTCVPHTKRCDGEADCPNGSDEKDCLFLASSVHEL
RSQSWSTPHVAKYNKEGYVVFNEKGTVGKLCTANLNATLPETEMDNVLQTAASSFGVASV
EVRTDDEEDVPYVYMEDPSAPEITFVRAPCPSKEVLYVRCSDLECGIQPLRTNDGTNGLN
KMAEPGDWPWHVALFKEGVHVCDATLVADNWLLTTAYCFQGQPKAEWSARLGVVRLSSTS
PWEQERRIVGMIKSPVEGTTVLVKLDRPVTTFSDFVRPVCLPSSEDPPSNTSQCNTLGWA
RNRDVLQRVQLKHSAMEKCENISIPSVNSVCTEQAYSTDDCNEEEVAGSSMLCLQTDDRK
WILTGIGSWRIACSKDGIERPRLYDKISSHIDWIKATIG
Download sequence
Identical sequences F4X7C8
Aech_02371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]