SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02426 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02426
Domain Number 1 Region: 778-883
Classification Level Classification E-value
Superfamily SEA domain 0.000000327
Family SEA domain 0.024
Further Details:      
 
Domain Number 2 Region: 892-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 940-978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  Aech_02426
Domain Number - Region: 716-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0791
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_02426
Sequence length 1190
Comment [mRNA] locus=scaffold89:2391731:2398922:+ [translate_table: standard]
Sequence
MSRENIVLSASAYTGPEKTSSRSHPDESWTFQRTVPAFQLESSKNVNDYDREETRIVFKD
TSHDESINELTSSKHVAHIDGNNIETKAGEYYHIVPTTSESMSGEGQGAPLRVDLLSEPH
QLVGAPRQRAQHSPADQQRRGRQETSRTYSMPPILQTAPPGRQANPDIQDIITGIVKLLN
GNVNVAANTVRPLRPIQATRINNRGPPRISDVPPLPSDFDTPGMNPPPPPSSHPYPFEKP
PAPDRPLLPPERPIRPFISGVPLPEQVVPPWSWDSSYNGNRRPSPYPPLSSLDSSFHRDK
NLSTTENSQYDLKPESETPQESSTIKKDASHQETLIEDDDTKNYASNSSKDRVETTVAFD
NSTIQNATKKHEPEESTKKPINHKYYTPSKENKINNEETLILGLATDVTSTHTIPHLESS
VASSNSEIKVTKSSKNEEKPFSTSKGEKSPEKVTSTILKTFSTSTLNIETSSSVQVIESM
STRVVLRPTATTVKSSVDTKFGVSLEPSSTSDIEYIETTSSVSTPTDGLPTTYSKNLVTT
EKNIHPTTSIFTKNTGKYRPRPGIVLDDTLDYTGAQGLPSQRPYIPSRHPSFGDVFDVTV
SAIQGPGGSSGESVRVSLNSGGSGGDVILTSAIGGEGFVSIDGKRTYLNLFDTTERTPTP
THVQSQPPRTQPPSIIGTGLAIPQPDSPVATSRPNVPNRRQPPLYRRPTQPPVRIDTCIV
GDTSTCDASQHEACATVQGVSACHCKPGYARLQHSLPCKKIVSIVVSIRVDKFYDKKVVW
DRGLADKDSESYQTLAYEANRAVESAMSMTPFSDEYMGSLINNVYQGDVSQGQGGVFVNA
TLKLTYEPRTIRSSLAGELQRHLLGVIHRRNNNIGNSALYVDSPPGSISNLQDLDECVSS
ELNDCHSSSSCTNTFGGFTCTCNSGLKDPHKNDPNESGRTCLSCPSTYCNNRGTCSYQGD
QMHCTCTGNYYGTQCEVDGEVLGVAIGASVAALIIIILTLVCLVMWSRKWSREQKSAGSP
VYGYIQGGIPGTLPGTLARVGSVGTLASVKQGPPTNLPPYMWAHFGEHMATANLYAFCLL
IRNFLKIFLLEDRTHGGTLPPVPLPRLQAPSRPRQRPQPDPDSSDSEPQDKDRADLIPQS
SGFHVPRPKSRSSLANQSGIYNDVEYDQGDVHHLSKNNIPMSTYRPYYRT
Download sequence
Identical sequences F4X721
Aech_02426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]