SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02480 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02480
Domain Number 1 Region: 45-198
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-18
Family C-type lectin domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_02480
Sequence length 216
Comment [mRNA] locus=scaffold142:942903:950052:- [translate_table: standard]
Sequence
MRAIYLLLLGVVAINAQRRLALPDPRSCANRVRHSSYRDGRGVVHSYFFSWEHLPTRSLE
VDWLDARNICRRHCMDAVSLETPQENEFVKQRLARGNVRYIWTSGRKCNFNGCDRPDLQP
QNINGWFWSGSGAKIGPTTQRNSGDWSNTGGYGQPQPDNREAAQGNDESCLSILNNFYND
GIKWHDVACHHVKPFVCEDSDELLNFVASRNPGIRL
Download sequence
Identical sequences F4W8F3
Aech_02480 XP_011068288.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]