SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02596 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_02596
Domain Number - Region: 19-77
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0336
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_02596
Sequence length 110
Comment [mRNA] locus=scaffold142:2269231:2270865:+ [translate_table: standard]
Sequence
MAKHHPDLIFCRKQPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI
CGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKRR
Download sequence
Identical sequences A0A026X234 A0A067QYM8 A0A0J7KQ32 A0A0L7QUZ6 A0A0T6B1A4 A0A151IJW3 A0A151WTA0 A0A158NKF7 A0A195B044 A0A195EIJ6 A0A195FAU3 E0VM53 E2AR49 E2B2Y8 E9IWY4 F4W8Q9 K7J3C4 V5FY11
vb|PHUM300840-PA|EEB14459.1|conserved Aech_02596 Hsal_06697--XP_001120124.1_APIME 121224.XP_002427197 7425.XP_001599584 XP_001599584.1.61660 XP_002427197.1.24195 XP_003484388.1.29386 XP_003701008.1.71094 XP_006623871.1.66377 XP_011068502.1.86870 XP_011154391.1.56509 XP_011164776.1.47049 XP_011262550.1.72520 XP_011297178.1.61867 XP_011334720.1.87679 XP_011506347.1.84716 XP_011506348.1.84716 XP_011638597.1.19355 XP_011686073.1.89273 XP_011858255.1.68811 XP_012058015.1.45171 XP_012135327.1.71094 XP_012135328.1.71094 XP_012222185.1.42766 XP_012261946.1.80111 XP_012273120.1.87881 XP_012526512.1.53737 XP_014217558.1.61449 XP_014232221.1.28516 XP_014232222.1.28516 XP_014484566.1.44477 XP_014611099.1.41157 XP_015122018.1.60272 XP_015174163.1.70865 XP_015433827.1.55303 XP_015516165.1.5119 XP_015586222.1.68462 XP_016915535.1.2121 XP_017786810.1.89798 XP_017793170.1.86229 XP_017887751.1.74565 XP_018054943.1.4000 XP_018309605.1.62676 XP_018344562.1.14990 XP_018378412.1.32933 XP_018394190.1.22276 XP_018573484.1.56492 XP_018573485.1.56492 XP_019869751.1.27284 XP_019869752.1.27284 XP_019884294.1.72520 XP_020295914.1.29359 PB20253-RA gi|156553793|ref|XP_001599584.1| Cflo_08403--XP_001120124.1_APIME AC10871-PA LH17581-PA SI2.2.0_12202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]