SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02756 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02756
Domain Number 1 Region: 1128-1331
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-32
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 2 Region: 198-320
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-25
Family Cadherin 0.00069
Further Details:      
 
Domain Number 3 Region: 537-644
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 426-513
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-19
Family Cadherin 0.00079
Further Details:      
 
Domain Number 5 Region: 95-210
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-18
Family Cadherin 0.0028
Further Details:      
 
Domain Number 6 Region: 632-761
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000214
Family Cadherin 0.0047
Further Details:      
 
Domain Number 7 Region: 749-852
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000942
Family Cadherin 0.0045
Further Details:      
 
Domain Number 8 Region: 343-433
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000471
Family Cadherin 0.009
Further Details:      
 
Domain Number 9 Region: 854-953
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000785
Family Cadherin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_02756
Sequence length 1525
Comment [mRNA] locus=scaffold316:2296790:2308024:- [translate_table: standard]
Sequence
MQYPQYPKWAISSSSVSSLCYSVCNEIEALETPGRKIAVPRRGLENTRANTGAISGVTHD
VGKVLCEILSGLRGLLDAKVCFTVRANTLDENHNHKPVFSNCASYAPVVKEEQPRDTTVI
QVHAEDRDPPEEGGTITYSFAKDPKDRLKFAINNKTGLITTTQILDRDEPAREKEVYLTV
LATDNGRPQLDDHCTFKVTIEDVNDNYPEFDKANYTESVPQDLPVGREVMRISATDVDNG
NNSIVRYSLSTERPDDIGYFWIERESGIIFLNKTIDRIPGSKFGMIVSAMDLGTEKLSSS
TSFYIQVVESHKKAPSFVPRPAEPIKLKEDFRDYDASIVRLQAVSNIDNSSNSDNLYLTF
ELVIGTTEQTNKEHTFRLESNKDVADIKLGLQLDYEKNTQYSLIVRVKNNYQLAAETVVD
IEILDVNDNIPVFRDIKGGSVLENEPPGVFVMQVRAIDADGTSANNQVTYELDNFKDFFA
IDPQTGNITTLMTFDREKQHIYNVKVIATDNSPSALFKTGEHNKGQQTFQIEIADKNDNP
PRFTRKVYTHNSIYENANIYEPITEVKVIDSDTASVITYSIISGNIDDSFHIEATTGKIR
VNKPLDYEKLTKYNLTVKAFDGLFNDTAQVEIFIENVNDNPPVFEDFDKNPTIDEEKLVD
GCITTVVAYDPDIEDRNADQHIVYFIAKEEQQPLIGIDKFGCMKLKKPLDRDPPNGFSTW
TVTVKARDEDDSPSALRELVTVNITLRDINDNAPFLDMQPVIWGENKPHGKITELKARDY
DSDDNGPPFKFRIDDTADNEIRSKFDIRDTNLYSRVMFDRERRKSYNIPIAITDSGVPPM
TGTSTLTVIIGDENDNPMREGSSSIFVYNYKGEAPDTEIGRVYVNDPDDWDLPDKSFKWA
SPHDGFHLDTSTGMITLLSGTTNDTFVLKFIVTEEGQNIPLHQVNAYVNVTVKELPEEAV
HRSGSVRFYGITAEQFVEPDESGVSKKDIFQEKLATMLNISVENVDVFTVLHSPHHNNRS
LLDIRFSAHGSPYYAPEKLNTIIAQHSKEIEREMKANILLMNIDECLFEKLHCNNSCRNF
LNTSTVPYVVYTNTSSFVGVRAVADPLCTCHMAEPIVCLNGGTPLVERCECPPGLEGPRC
ELLGIGFHGDGWAIMPSPDQICDDSHLGVEITPHVDNGLVFYFGPMTYNPKLRIQDFMSL
ELQQGFAVLYVDYGTGTVRLDQKQIKLTDGKSHRIDVYWKKTSIEMVVDKCGISACMSLT
APQGTNEFLNVNSPLQVGGTLTNLAHLASNLGWDYKPTNKGFVGCIRNMTFNRNTYNLGM
PSLSRNADPGCDHGMAKAISFGIDTNFIVAILVCVLILLILLVAVVVHRRKTDDMYKDMD
DIRENIINYEDEGGGEVDTGYDLNVLRAIYDAPPIDSKIVPIGLQGRGTDEVPDICGFLD
GKKENCDKDPETNPFDDVRHYAYEGEGNSEGDLSSLASCTDDGDLKFNYLSNFGPRFRKL
ADMYGEDPSDDESDGVGERGSESWC
Download sequence
Identical sequences F4WLC7
Aech_02756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]