SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02778 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02778
Domain Number 1 Region: 59-161
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00038
Further Details:      
 
Domain Number 2 Region: 189-298
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_02778
Sequence length 505
Comment [mRNA] locus=scaffold316:2760749:2769158:- [translate_table: standard]
Sequence
MRLQLRRAGIAFSLIMLLVIFEFCTSNNATWASNRDKKMRIVRKLRKDFRKLKKQEGALK
LTGGENGEHEGNVEILHDGKWGSICDDEWDDFEANVVCKQLGYNGAIKATTYGYFGQARR
RYWMDNVYCDGSEIELAKCRFDGWGISDCGSNEAAGVICSRDEETRSSPPISQEKPVKTR
LKDTYQQGTALRLSGGRVHSEGRVEIKLGSTDWGVICGDSWSILEAAVVCRQLGLGYASD
AVQTNFFGNGEIIPISISGVQCNGNEGNLAECLHDKVADCPGSTENMAGVVCHREMADLV
FDHIELMRTAHLEDRQLYWLQCAMEENCVASQAYKMQSESENWHLETRRLLRFTARILNA
GTADFRPSVPKHLWEWHMCHMHYHSMEVFATFDVIDSSGNKVAEGHKASFCLEDNQCIPD
VQPRYKCANYGDQGISVNCSDIYKHNIDCQWVDISELEPGHYTLKVAVNPEFKVGEMSFD
NNAAICRLLYTETFATVHSCVMGRP
Download sequence
Identical sequences F4WLF0
Aech_02778 XP_011055157.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]