SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02800 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02800
Domain Number 1 Region: 1509-1622
Classification Level Classification E-value
Superfamily C-type lectin-like 6.59e-46
Family Noncollagenous (NC1) domain of collagen IV 0.00000461
Further Details:      
 
Domain Number 2 Region: 1402-1508
Classification Level Classification E-value
Superfamily C-type lectin-like 2.14e-41
Family Noncollagenous (NC1) domain of collagen IV 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_02800
Sequence length 1623
Comment [mRNA] locus=scaffold135:254660:267845:- [translate_table: standard]
Sequence
MPGAPRNCTGSGCCAPKCFAEKGSRGPPGIIGPQGPKGQRGFPGAEGLLGSKGEKGDPGP
QGPHGVKGDRGKMGMPGFPGINGVPGVQGSPGSPGVPGRDGCNGTDGERGRDGVPGEPGP
RGLRGLLGPKGEKGQPAYAGAFPVGQKGEPGMDGVRGPPGPPGYQGERGLSGPKGERGPY
GAPGILGPKGEKGNMGLGFEGLKGDKGQKGEPGPPGSTAPIMPFVGGPEIHGGPPGEPGY
KGDKGEMGPEGQKGEPGFIGDHGIPGGLGQKGEKGLPGAPGIRGRDGFSGPPGPPGRKGD
RGIDGLEGLSGRPGKKGEPGRDGTMGVPGLRGPPGPPGGGKGRPGPPGPKGPRGFPGPTG
PRGADGFPGDPGPRGPVGLQGGPGSNGIPGPEGLPGEKGAKGEPGLTGFPGGPGPRGFDG
PPGAVGPRGPPGDKGFSIMGPKGMDGTPGLDGEKGQKGERGYAGVRGRPGDSLDGIPGAP
GAPGEPGEAGAPGRDGVPGLSGASGEKGDIGGRCIDCIPGLRGAKGDRGFDGTPGLTGPR
GPPGERGFPGEAGVDGLPGTIGPPGSPGKDGIPGAPGPQGEPGIPATVTWSMLKLEKGDK
GARGEPGRQGPPGPEGPPGEKGRPGFEGFPGLKGTPGDRGFPGQDGVPGRPGTPGRRGEK
GLSVKGEPGESGRPGFSGQKGEPGLYGLKGEPGQCPPLDLMKGFKGDRGLTGDKGEPGPP
GRDGLPGDKGLHGLSGPPGTPGPIGAPGPVGPRGLPGPRGDKGNMGPMGFPGEPGREGPR
GFPGAPAPKGEKGEPGISVKGSPGLTGPPGEKGEKGLPGPPGKEGPRGYQGLAGFTGEKG
DMGPPGINGLPGAPGAKGDTGPIGPPGPPGAAGIPGADGIKGEPGLPGEPGRGGLPGFPG
AKGDRGEPGIDGPKGYPGRRGLPGPSGRDGIDGAKGESGKPGIGRDGLPGLKGESGVPGR
DGLPGFQGQKGDTGVRGFPGIKGDYGPPGIPGEPGPPGIDGLPGEVGEIGPQGVPGFSGI
DGEMGPPGRPGLDGIKGDRGLQGVVGLPGIQGALGEKGDRGPPGPTIQIKGEKGEPGIPG
FSGEKGEKGNQGVIGLSGYDGEKGDRGLPGLEGSSGPHGAPGSKGEQGPAGIPGVPGVTI
KGEKGLPGLLGKHGRDGFPGRPGEKGEPGLPGLPGPKGDIGPYGPVGPQGEKGDQGPPGL
TGPPGRDGNSGLEGVPGSPGERGQKGEQGPPGVFGAPGQKGESGFPGPNGLDGPQGEKGE
RGWDGVNGLPGPIGQKGDRGYPGTVGSMGAVGYEGEKGEKGEDCLEPPMGPKGDRGYPGP
AGSPGPQGEKGIPGPPGFPGIDGIKGAQGFIGPPGPPGLSGLPGPVGATGLPGLQGPVGA
PGLIGEPGAPCETTPDYLTGILLVKHSQSQSVPICEPGHIRLWEGYSLLYTDGDERAHSQ
DLGYAGSCVRKFSTIPFLFCDVNNVCHYASRNDRSYWLSTNRPIPMMPVEEAAIEEYISR
CVVCEVPANVIAVHSQTISIPECPAGWTGLWIGYSFVMHTGAGSQGGGQSLSSPGSCLED
FRATPFIECNGAKGHCHYYSNQYSFWMVTIEDGQQFRSPEKQTLKAGNLRSRISRCQVCI
KNT
Download sequence
Identical sequences F4W7A9
Aech_02800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]