SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02803 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02803
Domain Number 1 Region: 1401-1510
Classification Level Classification E-value
Superfamily C-type lectin-like 3.53e-42
Family Noncollagenous (NC1) domain of collagen IV 0.0000128
Further Details:      
 
Domain Number 2 Region: 1513-1623
Classification Level Classification E-value
Superfamily C-type lectin-like 3.77e-41
Family Noncollagenous (NC1) domain of collagen IV 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_02803
Sequence length 1705
Comment [mRNA] locus=scaffold135:318258:332591:+ [translate_table: standard]
Sequence
GNPGVSGVMGPDGLDGCNGTDGRAGAPGIPGVFGPRGVPGPSGDYGFPGEPGDGGINSVG
AKGIRGNPGIDGLEGYQGQQGLTGDMGYPGDTGDFGLPGSPGLPGMQGERGDTVYGVNGQ
LGEQGDRGEPGPPGKDEYKKNTEHSPVKGPQGAKGMKGFYGDRGRKGELGAKGPQGRPGF
LGIKGIKGEQGDDGPRGKQGVGGPPGPADEKGEKGAPGFAGLPGPDGDDGEPGEEGNRGP
PGRQGAEGELGQYIPELDEIIAGNIGIQGDLGPPGEPGETGTPGLPGKVGFIGPPGPPGL
PGNPGFAGVKGSSIKGEQGDDGLSGPVGPQGSSGLPGLPGIMGAKGFPGVTITGPPGPDG
NPGLPGLSGPPGDRGDPGPPGEKGFPGKGIRIRGPPGERGLPGTPGISGPDGWPGFTGPK
GTKGIRGDDCGVCVPGLPGEKGQRGESGLDGYPGTTGFSGLPGPRGLKGVLGKRGVPGPA
GLEGDNGRPGIAGVQGPKGEQGKIFFPPGESIVSPPGDFGEKGLPGPEGIRGLRGQPGPI
GDTGVPGPKGDKGEHGSPGLSGKDGLPGWDGIPGEKGEDASIPIEFLRGDPGYPGEEGIK
GIQGDKGNKGEPGVSAEYIADSQGDKGYKGDRGAPGENGFKGFEGRSGDEGLLGLPGEPG
SPGISLQGPIGLKGYPGMPGDQGLRGTSGSPGLQGPVGFPGRIGNKGERGEPGSNLTYGE
IGERGWYGPKGDFGDAGPQGLRGRTGEDGVKGIKGAKGAPGYEGLSGLEGAKGQHGDSIQ
GDRGFPGQPGMPGMSGRIGDVGIRGPDGPSGFDGMKGLKGEIGFIGRRGDDGDIGPQGYQ
GMHGAQGLPGAPGEKGDVGESGDSGSRGWPGVKGIDGASGSKGEVGDAGVPGFSGVPGLP
GFKGITGDAGPEGLSGIPGENSFSGPQGDVGEHGFMGELGPPGLAGFDGRPGLPGEPGLA
TDGFNGLQGQKGEPGFDGYNGREGPKGEIGDMGPDGLKGEQGEQGFPGRSGAHGISGRHG
AKGERGLIGPPGFDGLKGKSGLDGDPGIMGRPAPGPKGHVGEPGLPSYAFAEKGDFGNRG
HDGFSGVKGQPGEPGYIGVPGRKGQIGDRGYPGPDGFLGLPGFPGLPGDQGPHGAPGLPG
EFAEPGEPGRAGLDGMPGIPGRAGQKGAPGEYGPNGPKGISGDIGHSLRGPKGIVGEPGL
RGFVGFPGAPGLEGFQGFLGAPGPKGFRGEPGISADSAKGQPGEPGWRGLDGRTGLKGMR
GDSGLSGIDGLPGQKGERGETGETGLPGLLGPEGPKGSKGQPGINPFPPFPRRGLPGDIG
VSGLPGFPGLQGMIGEPGKDGLPGRQGETGMIGIPGLQGPDGKDGPPGYQGSRGPTGRQG
KQGFPGAPGLPAPNGIGPRDRGFYFARHSQSEMIPVCPRNTVKIWEGFSLLHIMGNGRAY
AQDLGAAGSCVRKFSTMPFLFCNLNNVCDYANRNDYSYWLSTTEPMPMMMTPIPAPEVGR
YLSRCSVCEAPTRVIAVHSQSMAIPECPGGWEEIWVGYSFLMHRDAGADGGGQSLVSPGS
CLEEFRVRPFIECRGLGSCNYFSTATSYWLATIHDDEMFRKPLQQTLKADHTSRVSRCAV
CLRRRVTEVLKPFTSNNERAPNNWGIIPPPRQLPPDYESSRIPPNPWATHTRGRPYSNRR
VPHHQRRRGRVRGRHWESAESLNNV
Download sequence
Identical sequences F4W7B1
Aech_02803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]