SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02828 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02828
Domain Number 1 Region: 1449-1578,1606-1671
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-37
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 798-905
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-30
Family Cadherin 0.00069
Further Details:      
 
Domain Number 3 Region: 477-590
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 905-1008
Classification Level Classification E-value
Superfamily Cadherin-like 4e-29
Family Cadherin 0.0004
Further Details:      
 
Domain Number 5 Region: 1694-1876
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-27
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 6 Region: 360-475
Classification Level Classification E-value
Superfamily Cadherin-like 7.59e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 578-693
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-26
Family Cadherin 0.00099
Further Details:      
 
Domain Number 8 Region: 690-799
Classification Level Classification E-value
Superfamily Cadherin-like 3e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 1004-1124
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 10 Region: 258-358
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-19
Family Cadherin 0.0038
Further Details:      
 
Domain Number 11 Region: 1116-1213
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000982
Family Cadherin 0.015
Further Details:      
 
Domain Number 12 Region: 1386-1427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000141
Family EGF-type module 0.0069
Further Details:      
 
Weak hits

Sequence:  Aech_02828
Domain Number - Region: 2009-2049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 1914-1953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00405
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 2058-2111
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0102
Family Hormone receptor domain 0.0081
Further Details:      
 
Domain Number - Region: 2474-2773
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0165
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number - Region: 1882-1912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_02828
Sequence length 3164
Comment [mRNA] locus=scaffold135:684458:697512:+ [translate_table: standard]
Sequence
MARWRWVLLILTTIWTLGDGYLTVLPSSTPVGTVVFEAGVPQLGGRRKYEASSERTAWFA
RKLLKVHPHTGRVTLAKTLSCEGLQYPRVFTFYVDSTSSRLGRPTIDYYSLPLRILITGC
GGENHDLAATRGWMAETLASYAMPSTDRFTEVCLRTSQLVAALRDFLPQTTLKECETRWG
GVADPRFLVEGAAGDLVSATEQCLVDPLWKVSVSMNLRCTGDSRLTDAEHRLKIVFHHHQ
LDDTDLGRRVRRELKNQSPYFEQHLYLAAVEEEKEPGMYVTSVKARDPENGAVRYSMSSL
VDARSQALLALDPVTGRVTTRARLDRENVDVHYFRVLAVDDSFPPRTGTTTLQVNVLDAN
DHTPSFEGPEYDASVREGVPVGSTVITVKATDQDTGRNAEVEYSIVSIMAGSSITHMEDT
ATFRIDPRSGVVTTRTPLDREQTEIYTVVLSVTDQATPPSARRSSNATLVVRVLDDNDNY
PQFTERTYSATVPEDLDYTTNPVIARIRAMDADAGANAAVRYAIIGGNTQNTFSIDSMNG
DVTLVKPLDYESTRSYKIVIRAQDGGSPARSNTTQLLVMVRDVNDNAPRFYTSHFQESVS
ESVPVGYSILRVQAYDADEGNNALIKYTIGARDFTGASTENFPITVKAETGWIYTTKQLD
REQCSKYQFTVIAADSGEEPKSASATVFLTVTDVNDNDPYFEPKTYEAVVSEDSLAGTPV
TTVTATDPDEDSRIHYEITGGNTRGRFSISSQNGRGLITIAQTLDYKQEKRFVLTVTASD
TGSRTDTALVYVNVSDANNYSPEFENAPYSVSVFEDAPIGVTVLVVSATDADVGKNAQIT
YSLATDNGEQVITEFTINSQTGAITTTKALDRESVPSYLLTVTARDGGVPSLSDTTDVEI
SVTDVNDNAPVFEAPQYHGSILEDVLLSTSVLRVAATDADTDLNGRVRYGLEDDGDGAFT
IDSTTGIIRTAKILDRESVAYYTLKAVATDRGSPALSSIVPVTIKIEDINDSPPAFENDK
IILYITENSPIGSTVGEIYAHDPDEGPNAVVQYSIIGGEDSNSFSLNVRQGADRAELITL
EELDYESPKKKFELVVRAASPPLRSDAVVQILVTDVNDNAPVLKDFQIIFNNFKDFFPTI
PIGRIPAVDADVTDNLVYSILAGNNANLIDLNRTSGEIRLSPQLNTNVPRVATMEVAVTD
GINEAKATMTLSVRLITDEMLLNSITVRLDDMTVEAFLSPLLGYFLDGLAAIIPCPRENI
FLFSVQEDANVQGKILNVSFSARKVEPGTVDEFYSPQFLQERVYLNRGILARLATVTVLP
FDDNLCVREPCLNFEECLTVLKFGNASGFASSDTVLFRPIYPVTTFACRCARGFTGSREA
YMCDTEVNLCYSNPCMNGGICHRREGGYSCICQPDFTGVNCEISMNRDACSPGICKGDSQ
CTMKNTAGFTCEGCPVSALESVTPFCELKARSFGPATFLTFASLKQRHRLHLRLKFATEL
ADGLLLYNGRYNERHDFIALEIVDSCVQFSFSLGDEVTRATATVPGGVSDGQWHEVEVSY
MNRTVTVSLDDCDVALALKHGEKRLGPKWTCAGRSERVLEERCGLVTETCHRFLDLTGPL
QLGGLPAIPSSFQIRNKDYVGCISDLYIDHVFVDLNSFVADNGTNVGCPEKVAFCASSPC
RNNGKCREIWSGFVCECEHNFAGPTCAEEIGAPYSFHSNGMLGFNPLLRPIQLPWTTALS
LRTRAQVAFVMSVQIGQNSSVLLEIRNGKLVVSLDGADVIRTGGTVADGEWHRMEIVWQS
SHVSLDTDYRERPVTVPLPAKLQGLYVGRILVGGPDQVTNIDLPFFDGCLQDIRIGTNQS
VLQRPTIQENVDAGCPSETYCNTECPQASICIAQWRSSECVCAAGHVGNNCERICNLEPC
SDAGTCIEDTTDLRRGYQCKCASSDISGEYCETKSEQPCPATWWGSPICGPCHCDETKGY
DPACNKTTGECHCKENHYQPNGRKECIPCECYTTGSFGPRCDSETGQCRCRTGVIGRSCT
DCPNSYAEVTLRGCEVVYDGCPRSYSDGLWWPRTLFGLTAIEDCPGTAEGKTSRSCDDKL
GGWQPPDLFNCTSEVFIEHRHQLAALETKDLTLNTYVAVKMAKDVHRAVNITREMYGADL
LVTESLLVALLRYEESLVGLNLTHSQDKDYVTHLIGIAGAILRSKYKEKWDKIGELNGDS
PDKILDAMARYLKTLTASQHDTFTNPFEVVNDNVVLGLDIVTSESLFGYETIEYKEDPTV
STARPAEADRKVILPDTSAFLSSSAHFGPSISFPKYNNYMADPSRFDPHSKIQVPLNTLG
IKPVIQGELNVKNSLNNRKAVLSYVQYKELGILLPQRFDDSVSVRWGVEVAVGSPVMTVS
VLVPSDDGYESLTGIPLQSPIQVRLWLLENDDFKTRTNPQCVHWSTARGIGEWSRMGCTT
EIEDNSLSFGTIVNCSCMKLSTFAILTDVLDLEYVPEPSLLEDVTSYSAFMLALPLLLSA
LLILALIRGGGTNSNSIHKNLVLCVFMAEILYLIALKARNPLVSNEFPCKLTAIGLHYAW
LSTFAWTLVDSVHLYRMLTEMRDVNHGQMRFYYTMGYGLPAVIVGLTIGVRADQYGNFYF
CWLSIYETVIWSLIGPVCVAVLVNFCILVMCIRAAFTLKEHIMGFGNLRTLLWLSVASLP
LLGSTWTLAVLNASENSPMLSYLLSVAIVVHAAFSLIGYCFINSRVRRNLYQSLLRCIGK
KTPLLEGSMGNGSSSQNVNGHSRSALAYSSTYNGAESVCKRVHVGVSTSSTTSRSTNKTG
SSPYRSDTHLRHTSTSTSNYNSDRDPYLSSRSHRSALHSRQESTEIRGQRRESESDSDGS
QAEGGGRSLDLASSHSSDEDDVTSRSHRNMGVSTQQHVTHSYLPNIHTNPAEHLNILCSN
AELFPNIKPIYAPRWSSQLPEAYLSSNVMDVRSSQWSGGTMSDNEIASNKTSSPNPLPYP
EMNSPQKNQPDENYSEGEEKIHHLGEKYLFPYTAEEDHTVSPTPYMLSMSSRILASSMSH
HSQNSNHENLSGSEQRYGSLKRGQSLHGSQHDNLSGSERYGSLKRGKMGTPTVLEDRPEY
ILPMSGRILSSSLTHDLQHSNELAALRQQQQQQQQYEQTITETE
Download sequence
Identical sequences F4W7D3
Aech_02828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]