SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_03065 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_03065
Domain Number 1 Region: 631-939
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-84
Family Protein kinases, catalytic subunit 0.000000113
Further Details:      
 
Domain Number 2 Region: 458-549
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-27
Family Kringle modules 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_03065
Sequence length 1087
Comment [mRNA] locus=scaffold159:2585126:2596159:- [translate_table: standard]
Sequence
MLVDVHNMKPDRHYFHYQQPLISSQVQSKLEVASIDHSSELMREQHHNFSRSISFRAPLG
TCSKRLAILFIDETEQKLNNARESRKMAEEEKWVKRENKRTLELRSKYSAQIQKTQYNGI
ISPIHPEHPIGQPSGDRFSTGMSGFMDGMGHGDMLDISGTGMSTPHISHLASANPFNILS
PSPQPTSSQSSTMDFNTLSGLTNGNIQFPPNMNFDEMSSISSVSGRKDNHKGTCEVYIGK
TCAQFVGNQSVYIIYPMTQKMLEEKLMKAFQVINFSNELSSNCEGYAKPSLCYSAFPICR
DPFNIKKPKNAEASTQLFNLLNSKQDDFLDDGDRDDTDDFSRLHSVPKRSPTLGPVFNFM
PNEDGKSSNKKIINQSYGDARASSRNEINRKLRRICREECEMLENELCRKEYAIAKRHPL
IGHQVPLVECSDLPLEGTTEARDCLTLGLSVVNNVQENDYCYWGSGKSYRGIVKTSVSGR
MCLRWSHHFNLPISDYPELAGRHSYCRNPGGKEIQPWCYVDVNNRMQKEFCSIPKCVENL
WIYAVVGFVLTGGFVIILICYCCCYRSRKSRRQMNHLPSNKMLTSIQCDKNIYDGRRSTT
QPMEMSSLLAGPGNTTPGTGTLSSGSSRTSNNRIPQFTTNNIVLLQELGEGAFGKVYKGE
LQTGNKCEPPIYVAVKTLKENATPKTQSDFKREVELMTDLRHPNIICLLGVILKGEPMCM
LFEYMTQGDLHEFLICHSPRSDVPLNNSGGKILEQPEFLHIALQIASGMEYLASHHYVHR
DLAARNCLVGDNLTVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPPESILYGKFTTESD
VWSFGVVLWEIYSYGLQPYYGYNNQEVIDMIRSRQLLPCPEDCPTMIYSLMIECWHEVAN
RRPQFPEIHHRLHNWYINQTYLSDFCNESITSYSGSSHKSTNKTNSTQLSAPIYKSDQKT
GTEPVNMCNLNDHNNVIKMLPPTNFPNSNCVEQRPNCGFSTEHGTPIKTSNYQNPTTNVN
LNDVYDDKQCCSPKLSGAKKVLPAVVPQSGIPKPNVPNGSRPMQNGAQLVVRLPDPSKVT
TETRVSK
Download sequence
Identical sequences F4W9T8
Aech_03065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]