SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_03274 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_03274
Domain Number - Region: 43-92
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00278
Family C-type lectin domain 0.013
Further Details:      
 
Domain Number - Region: 180-198
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0863
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_03274
Sequence length 411
Comment [mRNA] locus=scaffold140:70011:74061:- [translate_table: standard]
Sequence
MSTTTDVSDLAVDLPKEGTPIFLQTRAAWAIAGVFMAVALFFTCQQIYQHLRWYTNPTEQ
RWIVRILFIVPIYAIYSWISLLFFNSESYYVYFFTVRDCYEAFVIYNFLSLCYEYLGGEG
NIMSEIRGKPIRSSCLYGTCCLVGKTYTIGFLRFCKQATLQFCLVKPVMAFVIIFLQAFG
HYRDGDWSPDGGYIYITIIYNISVSLALYGLFLFYFATRDLLTPFEPVLKFCTVKSVIFL
SFWQGVLLAILEKANVISPVINSLGQSTSAGTVSAGYQNFLICIEMLFAAIALRYAFPYQ
VYAAGCVTDSRGRSVTMQSISSSLKETMNPKDIMTDAIHNFHPQYQQYTQYSAGGPKGQR
GMRVSSFDPDDPQNMPVPPPQRRNTSHQRVATISQNYNEKTMLLSSDDEFQ
Download sequence
Identical sequences Aech_03274 XP_018303793.1.62676 XP_018354815.1.14990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]